General Information

    • DRAMP ID

    • DRAMP00334

    • Peptide Name

    • Antiviral protein GAP-31 (Ribosome-inactivating protein; Plant defensin)

    • Source

    • Suregada multiflora (False lime) (Gelonium multiflorum)

    • Family

    • Belongs to the ribosome-inactivating protein family (Type 1 RIP subfamily)

    • Gene

    • Not found

    • Sequence

    • GLDTVSFSTKGATYITYVNFLNELRVKTKPEGNSHGIPSLRKSSDDPGSSFVVAG

    • Sequence Length

    • 55

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00334 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00334.

Physicochemical Information

    • Formula

    • C259H408N70O84

    • Absent Amino Acids

    • CMQW

    • Common Amino Acids

    • S

    • Mass

    • 5846.51

    • PI

    • 8.34

    • Basic Residues

    • 7

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +2

    • Boman Index

    • -88.81

    • Hydrophobicity

    • -0.333

    • Aliphatic Index

    • 72.55

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 55.19

    • Polar Residues

    • 24

DRAMP00334

DRAMP00334 chydropathy plot

Comments Information

    • Function

    • Single-chain ribosome-inactivating protein, possessing high antiviral potency and low toxicity to normal cells in culture and to intact animals. Capable of inhibiting HIV-1 infection and replication.

    • Catalytic activity

    • Endohydrolysis of the N-glycosidic bond at one specific adenosine on the 28S rRNA.

Literature Information

  • ·Literature 1

    • Title

    • A new class of anti-HIV agents: GAP31, DAPs 30 and 32.

    • Reference

    • FEBS Lett. 1991 Oct 7;291(1):139-144.

    • Author

    • Lee-Huang S, Kung HF, Huang PL, Huang PL, Li BQ, Huang P, Huang HI, Chen HC.