General Information

    • DRAMP ID

    • DRAMP00428

    • Peptide Name

    • Defensin-like protein AX2 (Antifungal protein AX2; Cys-rich; Plant defensin)

    • Source

    • Beta vulgaris (Sugar beet)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • ATCRKPSMYFSGACFSDTNCQKACNREDWPNGKCLVGFKCECQRPC

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

      • Fungi: Cercospora beticola, Botrytis cinerea, Fusarium graminearum, Bipolaris maydis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00428 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00428.

Physicochemical Information

    • Formula

    • C216H333N65O66S9

    • Absent Amino Acids

    • HI

    • Common Amino Acids

    • C

    • Mass

    • 5184.96

    • PI

    • 8.51

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +3

    • Boman Index

    • -103.43

    • Hydrophobicity

    • -0.628

    • Aliphatic Index

    • 21.3

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 166.44

    • Polar Residues

    • 20

DRAMP00428

DRAMP00428 chydropathy plot

Comments Information

    • Function

    • Strong inhibiting activity against C. beticola and other filamentous fungi. Little or no effect against bacteria.

    • Tissue specificity

    • Leaves and flowers.

    • PTM

    • Contains four disulfide bonds 3-46; 14-34; 20-40; 24-42 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Characterization and localization of new antifungal cysteine-rich proteins from Beta vulgaris.

    • Reference

    • Mol Plant Microbe Interact. 1995 May-Jun;8(3):424-434.

    • Author

    • Kragh KM, Nielsen JE, Nielsen KK, Dreboldt S, Mikkelsen JD.