General Information

    • DRAMP ID

    • DRAMP00881

    • Peptide Name

    • Circulin-E (CIRE; Plant defensin)

    • Source

    • Chassalia parviflora

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • KIPCGESCVWIPCLTSVFNCKCENKVCYHD

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.10691702]Virus: HIV-1 (EC50= 50-275 nM).
      • NOTE: EC50 = concentration that is 50% effective.
      • [Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=50-275 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (N termini to C termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00881 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00881.

Physicochemical Information

    • Formula

    • C148H228N38O43S6

    • Absent Amino Acids

    • AMQR

    • Common Amino Acids

    • C

    • Mass

    • 3420.03

    • PI

    • 6.71

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -25.63

    • Hydrophobicity

    • 0.09

    • Aliphatic Index

    • 68

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 13

DRAMP00881

DRAMP00881 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-20; 8-22; 13-27.

Literature Information

  • ·Literature 1

    • Title

    • New circulin macrocyclic polypeptides from Chassalia parvifolia.

    • Reference

    • J Nat Prod. 2000 Feb;63(2):176-178.

    • Author

    • Gustafson KR, Walton LK, Sowder RC Jr, Johnson DG, Pannell LK, Cardellina JH Jr, Boyd MR.
  • ·Literature 2

    • Title

    • Cyclotides as natural anti-HIV agents.

    • Reference

    • Biopolymers. 2008;90(1):51-60.

    • Author

    • Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.