• DRAMP ID

    • DRAMP00895
    • Peptide Name

    • Cyclotide hyfl-L (Plant defensin)
    • Source

    • Hybanthus floribundus (Greenviolet)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Cyclotides are plant-derived miniproteins that have the unusual features of a head-to-tail cyclized peptide backbone and a knotted arrangement of disulfide bonds.
    • Helical Wheel Diagram

    • DRAMP00895 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00895.
    • Formula

    • C137H215N33O42S6
    • Absent Amino Acids

    • HMQRW
    • Common Amino Acids

    • C
    • Mass

    • 3188.77
    • PI

    • 6.03
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Net Charge

    • 0
    • Boman Index

    • -2.49
    • Hydrophobicity

    • 0.537
    • Aliphatic Index

    • 71.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 115.69
    • Polar Residues

    • 16

DRAMP00895

DRAMP00895 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
  • ·Literature 1
    • Title

    • A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae).
    • Reference

    • Plant Cell. 2005 Nov;17(11):3176-3189.
    • Author

    • Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Göransson U, Craik DJ.