• DRAMP ID

    • DRAMP00939
    • Peptide Name

    • Type-5 thionin (Type V thionin; Plant defensin)
    • Source

    • Triticum aestivum (Wheat)
    • Family

    • Belongs to the thionin family
    • Gene

    • TTHV
    • Sequence

    • VDCGANPFKVACFNSCLLGPSTVFQCADFCACRLPAG
    • Sequence Length

    • 37
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00939 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00939.
    • Formula

    • C166H254N44O48S6
    • Absent Amino Acids

    • EHIMWY
    • Common Amino Acids

    • C
    • Mass

    • 3826.47
    • PI

    • 5.9
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • 0
    • Boman Index

    • -7.75
    • Hydrophobicity

    • 0.676
    • Aliphatic Index

    • 68.65
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 10.42
    • Polar Residues

    • 14

DRAMP00939

DRAMP00939 chydropathy plot
    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.
    • PTM

    • Contains three disulfide bonds 3-40; 12-30; 16-26.
  • ·Literature 1
    • Title

    • Extreme divergence of a novel wheat thionin generated by a mutational burst specifically affecting the mature protein domain of the precursor.
    • Reference

    • J Mol Biol. 1992 Apr 20;224(4):1003-1009.
    • Author

    • Castagnaro A, Mara±a C, Carbonero P, Garc­a-Olmedo F.