• DRAMP ID

    • DRAMP01022
    • Peptide Name

    • Cy-AMP1 (Plant defensin)
    • Source

    • Cycas revoluta (cycad seeds)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG
    • Sequence Length

    • 44
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria: Clavibacterium michiganensis (IC50=7.3 µg/ml), Curtobacterium flaccumfaciens (IC50=8.9 µg/ml);
      • Gram-negative bacteria: Agrobacterium radiobacter (IC50=8.3 µg/ml), Agrobacterium rhizogenes (IC50=8.5 µg/ml), Erwinia carobora (IC50=8.0 µg/ml).
      • Fungi: Fusarium oxysporum (IC50=6.0 µg/ml), Geotrichum candidum (IC50=7.4 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01022 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01022.
    • Formula

    • C198H298N52O58S8
    • Absent Amino Acids

    • EMNRW
    • Common Amino Acids

    • C
    • Mass

    • 4591.34
    • PI

    • 8.47
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +4
    • Boman Index

    • -31.42
    • Hydrophobicity

    • -0.341
    • Aliphatic Index

    • 28.86
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6460
    • Absorbance 280nm

    • 150.23
    • Polar Residues

    • 23

DRAMP01022

DRAMP01022 chydropathy plot
    • Function

    • Cy-AMP1 has antimicrobial activity against various plant-pathogenic fungi and bacteria.
  • ·Literature 1
    • Title

    • Purification, characterization, and sequencing of antimicrobial peptides, Cy-AMP1, Cy-AMP2, and Cy-AMP3, from the Cycad (Cycas revoluta) seeds.
    • Reference

    • Peptides. 2008 Dec;29(12):2110-2117.
    • Author

    • Yokoyama S, Kato K, Koba A, Minami Y, Watanabe K, Yagi F.