General Information

    • DRAMP ID

    • DRAMP01056

    • Peptide Name

    • Ha-DEF1 (H. annuus defensin 1; Plants)

    • Source

    • Helianthus annuus (sunflower)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ELCEKASQTWSGTCGKTKHCDDQCKSWEGAAHGACHVRDGKHMCFCYFNC

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Saccharomyces cerevisiae.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01056 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01056.

Physicochemical Information

    • Formula

    • C233H347N71O73S9

    • Absent Amino Acids

    • IP

    • Common Amino Acids

    • C

    • Mass

    • 5599.29

    • PI

    • 7.09

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -99.56

    • Hydrophobicity

    • -0.704

    • Aliphatic Index

    • 21.6

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 265.1

    • Polar Residues

    • 21

DRAMP01056

DRAMP01056 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Ha-DEF1, a sunflower defensin, induces cell death in Orobanche parasitic plants.

    • Reference

    • Planta. 2007 Aug;226(3):591-600.

    • Author

    • de Z©licourt A, Letousey P, Thoiron S, Campion C, Simoneau P, Elmorjani K, Marion D, Simier P, Delavault P.