• DRAMP ID

    • DRAMP01274
    • Peptide Name

    • Kunitz-type serine protease inhibitor PIVL;
    • Source

    • Macrovipera lebetina transmediterranea (Blunt-nosed viper) (Viperalebetina transmediterranea)
    • Family

    • Belongs to the venom Kunitz-type family
    • Gene

    • Not found
    • Sequence

    • QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVAS
    • Sequence Length

    • 60
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antitumor
    • Target Organism

    • IC50=250 nM on fibrinogen and 300 nM on fibronectin of glioblastoma cell line U87
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01274 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01274.
    • Formula

    • C297H442N88O89S7
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • ACN
    • Mass

    • 6893.73
    • PI

    • 8.61
    • Basic Residues

    • 10
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +4
    • Boman Index

    • -15558
    • Hydrophobicity

    • -0.847
    • Aliphatic Index

    • 29.5
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7825
    • Absorbance 280nm

    • 132.63
    • Polar Residues

    • 24

DRAMP01274

DRAMP01274 chydropathy plot
    • Function

    • Serine protease inhibitor that inhibits trypsin. Exhibits an anti-tumor effect and displays integrin inhibitory activity without being cytotoxiC. Is able to dose-dependently inhibit the adhesion, migration and invasion of human glioblastoma U87 cellS. Also impairs the function of alphavbeta3 and to a lesser extent, the activity of alphavbeta6, alphavbeta5, alpha1beta1 and alpha5beta1 integrinS. ##Miscellaneous
  • ·Literature 1
    • Title

    • PIVL, a new serine protease inhibitor from Macrovipera lebetinatransmediterranea venom, impairs motility of human glioblastomacellS.
    • Reference

    • Matrix Biol. 32:52-62 (2013).
    • Author

    • Morjen M. , Kallech-Ziri O., Bazaa A., Othman H., Mabrouk K., Zouari-Kessentini R., Sanz L., Calvete J.J., Srairi-Abid N., El Ayeb M. , Luis J., Marrakchi N.