• DRAMP ID

    • DRAMP01462
    • Peptide Name

    • Esculentin-2S (Frogs, amphibians, animals)
    • Source

    • Odorrana schmackeri (piebald odorous frog)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GLFTLIKGAVKMIGKTVAKEAGKTGLELMACKVTNQC
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus FDA 209P (MIC=2.6 µM);
      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=1.1 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01462 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01462.
    • Formula

    • C169H295N45O48S4
    • Absent Amino Acids

    • DHPRSWY
    • Common Amino Acids

    • K
    • Mass

    • 3853.71
    • PI

    • 9.51
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +4
    • Boman Index

    • -5.56
    • Hydrophobicity

    • 0.362
    • Aliphatic Index

    • 97.57
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.47
    • Polar Residues

    • 12

DRAMP01462

DRAMP01462 chydropathy plot
    • Function

    • Shows antibacterial against the Gram-positive bacterium S. aureus and the Gram-negative bacterium E. coli.
  • ·Literature 1
    • Title

    • Cloning from tissue surrogates: antimicrobial peptide (esculentin) cDNAs from the defensive skin secretions of Chinese ranid frogs.
    • Reference

    • Genomics. 2006 May;87(5):638-644.
    • Author

    • Chen T, Zhou M, Chen W, Lorimer J, Rao P, Walker B, Shaw C.