General Information

    • DRAMP ID

    • DRAMP01471

    • Peptide Name

    • Esculentin-1PLa (Frogs, amphibians, animals)

    • Source

    • Rana palustris (North American pickerel frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GLFPKINKKKAKTGVFNIIKTVGKEAGMDLIRTGIDTIGCKIKGEC

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=1 µM);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=12 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys40 and Cys46)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys40 and Cys46.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01471 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01471.

Physicochemical Information

    • Formula

    • C220H378N60O61S3

    • Absent Amino Acids

    • HQSWY

    • Common Amino Acids

    • K

    • Mass

    • 4935.97

    • PI

    • 9.76

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -46.06

    • Hydrophobicity

    • -0.091

    • Aliphatic Index

    • 93.26

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.78

    • Polar Residues

    • 15

DRAMP01471

DRAMP01471 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial against the Gram-positive bacterium S. aureus and the Gram-negative bacterium E. coli.

Literature Information

  • ·Literature 1

    • Title

    • Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris.

    • Reference

    • Biochim Biophys Acta. 2000 Nov 30;1543(1):95-105.

    • Author

    • Basir YJ, Knoop FC, Dulka J, Conlon JM.