General Information

    • DRAMP ID

    • DRAMP01475

    • Peptide Name

    • Esculentin-1ARb (Frogs, amphibians, animals)

    • Source

    • Rana areolata (crawfish frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.12429503]Gram-negative bacterium: Escherichia coli (MIC=3 µM);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=60 µM).

    • Hemolytic Activity

      • [Ref:12429503] HC50=120 µM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys40 and Cys46)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys40 and Cys46.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01475 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01475.

Physicochemical Information

    • Formula

    • C226H381N59O61S3

    • Absent Amino Acids

    • HQSWY

    • Common Amino Acids

    • K

    • Mass

    • 4997.05

    • PI

    • 9.57

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +5

    • Boman Index

    • -41.24

    • Hydrophobicity

    • 0.03

    • Aliphatic Index

    • 95.22

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.78

    • Polar Residues

    • 13

DRAMP01475

DRAMP01475 chydropathy plot

Comments Information

    • Function

    • Esculentin-1ARb has antibacterial against the Gram-positive bacterium S. aureus and the Gram-negative bacterium E. coli. Also exhibits hemolytic activity against human erythrocytes (HC50=120 µM).

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides and protease inhibitors in the skin secretions of the crawfish frog, Rana areolata.

    • Reference

    • Biochim Biophys Acta. 2002 Nov 19;1601(1):55-63.

    • Author

    • Ali MF, Lips KR, Knoop FC, Fritzsch B, Miller C, Conlon JM.