General Information

    • DRAMP ID

    • DRAMP01669

    • Peptide Name

    • Dermaseptin-2 (DS II; Dermaseptin-S2, DS2; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiprotozoal

    • Target Organism

    • Aspergillus fumigatus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01669 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01669.

Physicochemical Information

    • Formula

    • C155H255N43O43S2

    • Absent Amino Acids

    • CDEPRVY

    • Common Amino Acids

    • A

    • Mass

    • 3473.11

    • PI

    • 10.3

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +4

    • Boman Index

    • 5.06

    • Hydrophobicity

    • 0.382

    • Aliphatic Index

    • 92.35

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 166.67

    • Polar Residues

    • 10

DRAMP01669

DRAMP01669 chydropathy plot

Comments Information

    • Function

    • Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.

    • Tissue specificity

    • Expressed by the skin glands.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and structure of novel defensive peptides from frog skin.

    • Reference

    • Eur J Biochem. 1994 Jan 15;219(1-2):145-154.

    • Author

    • Mor A, Nicolas P.