General Information

    • DRAMP ID

    • DRAMP01911

    • Peptide Name

    • Brevinin-2GHc (AMP-4; Frogs, amphibians, animals)

    • Source

    • Rana guentheri (Gunther's frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • br2GHc

    • Sequence

    • SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus FDA209P (MIC=9.8 µg/ml), Bacillus subtilis ATCC 6633 (MIC>64 µg/ml);
      • Gram-negative bacteria: Escherichia coli O111 (MIC=19.6 µg/ml), Escherichia coli ATCC 25922 (MIC=9.8 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys24 and Cys30.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01911 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C145H239N41O40S2

    • Absent Amino Acids

    • HMQTY

    • Common Amino Acids

    • G

    • Mass

    • 3260.86

    • PI

    • 9.3

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -19.82

    • Hydrophobicity

    • 0.158

    • Aliphatic Index

    • 97.42

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 187.5

    • Polar Residues

    • 11

DRAMP01911

DRAMP01911 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide.

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • Problely contains one disulfide bond 24-30.

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri.

    • Reference

    • Peptides. 2006 Dec;27(12):3077-3084.

    • Author

    • Zhou J, McClean S, Thompson A, Zhang Y, Shaw C, Rao P, Bjourson AJ.