• DRAMP ID

    • DRAMP02310
    • Peptide Name

    • HbbetaP-1 (fish, chordates, animals)
    • Source

    • Ictalurus punctatus (Catfish)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH
    • Sequence Length

    • 33
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Antiparasitic, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP02310 helical wheel diagram
    • Formula

    • C173H254N44O46
    • Absent Amino Acids

    • CDIMR
    • Common Amino Acids

    • V
    • Mass

    • 4257.15
    • PI

    • 7.7
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Boman Index

    • -16.65
    • Hydrophobicity

    • 1.82
    • Aliphatic Index

    • 79.7
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6990
    • Absorbance 280nm

    • 218.44
    • Polar Residues

    • 8

DRAMP02310

DRAMP02310 chydropathy plot
    • Function

    • Showes moderate activity against Gram-negative bacteria, Aeromonas hydrophila and Vibrio alginolyticus, but no activity against Gram-positive bacteria such as S. aureus, Streptococcus faecalis S. iniae.
  • Literature 1
    • Reference

    • Dev Comp Immunol. 2008;32(11):1301-1312.
    • Author

    • Ullal AJ, Litaker RW, Noga EJ.
    • Title

    • Antimicrobial peptides derived from hemoglobin are expressed in epithelium of channel catfish (Ictalurus punctatus, Rafinesque).