General Information

    • DRAMP ID

    • DRAMP02432

    • Peptide Name

    • Antimicrobial peptide ISAMP (Ticks, Arthropods, animals)

    • Source

    • Ixodes scapularis (Black-legged tick) (Deer tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • PDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.19852941]Gram-positive bacteria: Bacillus cereus (MIC=5.8 µg/ml), Bacillus subtilis (MIC=12.3 µg/ml), Staphylococcus aureus (MIC=10.4 µg/ml);
      • Gram-negative bacteria: Escherichia coli Edl 933 (MIC=3.2 µg/ml), E. coli MG/655 (MIC=4.2 µg/ml).

    • Hemolytic Activity

      • [Ref.19852941]Insignificant hemolytic activity even up to 150 μg/ml against rabbit red blood cells

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02432 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02432.

Physicochemical Information

    • Formula

    • C216H338N74O64S6

    • Absent Amino Acids

    • FM

    • Common Amino Acids

    • CPR

    • Mass

    • 5187.88

    • PI

    • 8.98

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -138.75

    • Hydrophobicity

    • -1.094

    • Aliphatic Index

    • 31.74

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 285.89

    • Polar Residues

    • 18

DRAMP02432

DRAMP02432 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity and weak hemolytic.

    • Tissue specificity

    • Expressed in the fat body, hemocytes and salivary glands of partially-fed female ticks. Not expressed in the midgut.

Literature Information

  • ·Literature 1

    • Title

    • Exploring the sialome of the tick Ixodes scapularis.

    • Reference

    • J Exp Biol. 2002 Sep;205(Pt 18):2843-2864.

    • Author

    • Valenzuela JG, Francischetti IM, Pham VM, Garfield MK, Mather TN, Ribeiro JM.
  • ·Literature 2

    • Title

    • Purification and characterization of a novel salivary antimicrobial peptide from the tick, Ixodes scapularis.

    • Reference

    • Biochem Biophys Res Commun. 2009 Dec 18;390(3):511-515.

    • Author

    • Pichu S, Ribeiro JM, Mather TN.