• DRAMP ID

    • DRAMP02439
    • Peptide Name

    • U-theraphotoxin-Aju1a (U-TRTX-Aju1a; Juruin)
    • Source

    • Avicularia juruensis (Yellow-banded pinktoe)
    • Family

    • Belongs to the huwentoxin-2 family
    • Gene

    • Not found
    • Sequence

    • FTCAISCDIKVNGKPCKGSGEKKCSGGWSCKFNVCVKV
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • [Ref. Front.Microbiol.2012 Sep;3: 324-324.]Fungi: Candida albicans MDM8, C. albicans IOC 45588 (MIC=2.5-5 µM), C. krusei IOC 4559 (MIC=2.5-5 µM), C. glabrata IOC 45658 (MIC=2.5-5 µM), C. parapsilosis IOC 456416 (MIC=2.5-5 µM), C. tropicalis IOC 45608 (MIC=2.5-5 µM), C. guilliermondii IOC 455716 (MIC=2.5-5 µM) and Aspergillus niger (MIC=5-10 µM)
    • Hemolytic Activity

      • [Ref. 22973266] It has no hemolytic activity at 10μM against human human erythrocytes
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys3 and Cys24,Cys7 and Cys30,Cys16 and Cys35.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02439 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02439.
    • Formula

    • C172H280N48O50S6
    • Absent Amino Acids

    • HLMQRY
    • Common Amino Acids

    • K
    • Mass

    • 4012.77
    • PI

    • 9.08
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +5
    • Boman Index

    • -35.35
    • Hydrophobicity

    • -0.04
    • Aliphatic Index

    • 53.68
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 158.78
    • Polar Residues

    • 18

DRAMP02439

DRAMP02439 chydropathy plot
    • Function

    • Has strong antifungal activity. Has no hemolytic activity against human erythrocytes. Probable ion channel inhibitor (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
    • PTM

    • Contains three disulfide bonds 3-24; 7-30; 16-35.
  • ·Literature 1
    • Title

    • Juruin: an antifungal juruentoxin peptide from the venom of the amazonian pink toe spider, Avicularia juruensis, which contains the inhibitory cystine knot motif.
    • Reference

    • Front. Microbiol. 2012 Sep;3:324-324.
    • Author

    • Ayroza G, Ferreira ILC, Sayegh RSR, Tashima AK, Silva jr PI.