General Information

    • DRAMP ID

    • DRAMP02439

    • Peptide Name

    • U-theraphotoxin-Aju1a (U-TRTX-Aju1a; Juruin)

    • Source

    • Avicularia juruensis (Yellow-banded pinktoe)

    • Family

    • Belongs to the huwentoxin-2 family

    • Gene

    • Not found

    • Sequence

    • FTCAISCDIKVNGKPCKGSGEKKCSGGWSCKFNVCVKV

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • [Ref. Front.Microbiol.2012 Sep;3:324-324.]Fungi: Candida albicans MDM8, C. albicans IOC 45588 (MIC=2.5-5 µM), C. krusei IOC 4559 (MIC=2.5-5 µM), C. glabrata IOC 45658 (MIC=2.5-5 µM), C. parapsilosis IOC 456416 (MIC=2.5-5 µM), C. tropicalis IOC 45608 (MIC=2.5-5 µM), C. guilliermondii IOC 455716 (MIC=2.5-5 µM) and Aspergillus niger (MIC=5-10 µM)

    • Hemolytic Activity

      • [Ref. 22973266] It has no hemolytic activity at 10μM against human human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys3 and Cys24,Cys7 and Cys30,Cys16 and Cys35.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02439 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02439.

Physicochemical Information

    • Formula

    • C172H280N48O50S6

    • Absent Amino Acids

    • HLMQRY

    • Common Amino Acids

    • K

    • Mass

    • 4012.77

    • PI

    • 9.08

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -35.35

    • Hydrophobicity

    • -0.04

    • Aliphatic Index

    • 53.68

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 18

DRAMP02439

DRAMP02439 chydropathy plot

Comments Information

    • Function

    • Has strong antifungal activity. Has no hemolytic activity against human erythrocytes. Probable ion channel inhibitor (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains three disulfide bonds 3-24; 7-30; 16-35.

Literature Information

  • ·Literature 1

    • Title

    • Juruin: an antifungal juruentoxin peptide from the venom of the amazonian pink toe spider, Avicularia juruensis, which contains the inhibitory cystine knot motif.

    • Reference

    • Front. Microbiol. 2012 Sep;3:324-324.

    • Author

    • Ayroza G, Ferreira ILC, Sayegh RSR, Tashima AK, Silva jr PI.