General Information

    • DRAMP ID

    • DRAMP02902

    • Peptide Name

    • L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)

    • Source

    • Bothrops pirajai (Piraja's lance head)

    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)

    • Gene

    • Not found

    • Sequence

    • ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-, Antiparasitic

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa. Leishmania sp..

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02902 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02902.

Physicochemical Information

    • Formula

    • C235H375N63O74S

    • Absent Amino Acids

    • CHQW

    • Common Amino Acids

    • A

    • Mass

    • 5299

    • PI

    • 5.15

    • Basic Residues

    • 6

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 19

    • Net Charge

    • -1

    • Boman Index

    • -71.89

    • Hydrophobicity

    • -0.253

    • Aliphatic Index

    • 85.71

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 62.08

    • Polar Residues

    • 14

DRAMP02902

DRAMP02902 chydropathy plot

Comments Information

    • FunctionCatalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. This protein may also have activities in hemorrhage, hemolysis, and apoptosis.

    • Tissue specificity

    • Expressed by the venom gland.

    • Miscellaneous

    • Has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production.

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom.

    • Reference

    • Bioorg Med Chem. 2006 Oct 15;14(20):7034-7043.

    • Author

    • Izidoro LF, Ribeiro MC, Souza GR, Sant'Ana CD, Hamaguchi A, Homsi-Brandeburgo MI, Goulart LR, Beleboni RO, Nomizo A, Sampaio SV, Soares AM, Rodrigues VM.