• DRAMP ID

    • DRAMP03094
    • Peptide Name

    • Drosomycin-2 (Insects, animals)
    • Source

    • Drosophila melanogaster (Fruit fly)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC
    • Sequence Length

    • 44
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal, Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03094 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03094.
    • Formula

    • C204H317N61O63S9
    • Absent Amino Acids

    • FQT
    • Common Amino Acids

    • C
    • Mass

    • 4920.67
    • PI

    • 6.86
    • Basic Residues

    • 8
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -78.94
    • Hydrophobicity

    • -0.511
    • Aliphatic Index

    • 44.32
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12990
    • Absorbance 280nm

    • 302.09
    • Polar Residues

    • 19

DRAMP03094

DRAMP03094 chydropathy plot
    • Function

    • Drosomycin-2 is antiparasitic peptide which shows inhibitory effect on the ookinete development of the parasite Plasmodium berghei.
    • Induction

    • Expressed in larva, pupa and adult.
  • ·Literature 1
    • Title

    • Gene expression, antiparasitic activity, and functional evolution of the drosomycin family.
    • Reference

    • Mol Immunol. 2008 Sep;45(15):3909-3916.
    • Author

    • Tian C, Gao B, Rodriguez Mdel C, Lanz-Mendoza H, Ma B, Zhu S.