General Information

    • DRAMP ID

    • DRAMP03110

    • Peptide Name

    • Andropin (Insects, animals)

    • Source

    • Drosophila mauritiana (Fruit fly)

    • Family

    • Not found

    • Gene

    • Anp

    • Sequence

    • VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK

    • Sequence Length

    • 34

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiprotozoal

    • Target Organism

    • Leishmania panamensis (EC50=23.45 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03110 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03110.

Physicochemical Information

    • Formula

    • C170H287N43O45S2

    • Absent Amino Acids

    • CRSTWY

    • Common Amino Acids

    • I

    • Mass

    • 3717.53

    • PI

    • 8.36

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +2

    • Boman Index

    • -8.72

    • Hydrophobicity

    • 0.329

    • Aliphatic Index

    • 126.47

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 3

DRAMP03110

DRAMP03110 chydropathy plot

Comments Information

    • Andropin is constitutively expressed in the adult male ejaculatory duct in response to mating not bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.

    • Reference

    • J. Mol. Evol. 2002; 54:665-670.

    • Author

    • Date-Ito A, Kasahara K, Sawai H, Chigusa SI.