General Information

    • DRAMP ID

    • DRAMP03217

    • Peptide Name

    • M-oxotoxin-Ot1a (Oxyopinin-1, Oxki1; spiders, Arthropods, animals)

    • Source

    • Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal

    • Target Organism

      • [Ref.11976325]Gram-negative bacterium: Escherichia coli (MIC=1.6 µM);
      • Gram-positive bacteria: Bacillus subtilis, Staphylococcus aureus (MIC=6.2 µM).

    • Hemolytic Activity

      • [Ref.11976325]100% hemolytic activity at 50 µM against sheep red blood cells

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03217 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03217.

Physicochemical Information

    • Formula

    • C235H409N71O60S

    • Absent Amino Acids

    • CHTWY

    • Common Amino Acids

    • AK

    • Mass

    • 5221.33

    • PI

    • 11.26

    • Basic Residues

    • 12

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +10

    • Boman Index

    • -67.16

    • Hydrophobicity

    • -0.204

    • Aliphatic Index

    • 103.96

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 7

DRAMP03217

DRAMP03217 chydropathy plot

Comments Information

    • Function

    • Disrupts cell membranes, particularly those rich in phosphocholine, through formation of pores. Has antimicrobial activity against Gram-negative bacterium E. coli, Gram-positive bacteria B. subtilis and S. aureus, and hemolytic activity against sheep erythrocytes. Has insecticidal activity against S. frugiperda ovarian cells by opening non-selective ion channels. Enhances the insecticidal activity of spider venom neurotoxic peptides.

Literature Information

  • ·Literature 1

    • Title

    • Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins.

    • Reference

    • J Biol Chem. 2002 Jun 28;277(26):23627-23637.

    • Author

    • Corzo G, Villegas E, Gómez-Lagunas F, Possani LD, Belokoneva OS, Nakajima T.
  • ·Literature 2

    • Title

    • Pore formation of phospholipid membranes by the action of two hemolytic arachnid peptides of different size.

    • Reference

    • Biochim Biophys Acta. 2004 Aug 30;1664(2):182-188.

    • Author

    • Belokoneva OS, Satake H, Mal'tseva EL, Pal'mina NP, Villegas E, Nakajima T, Corzo G.