• DRAMP ID

    • DRAMP03224
    • Peptide Name

    • M-ctenitoxin-Cs1c (M-CNTX-Cs1c; Cupiennin-1c; spiders, Arthropods, animals)
    • Source

    • Cupiennius salei (Wandering spider)
    • Family

    • Belongs to the cupiennin family
    • Gene

    • Not found
    • Sequence

    • GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQTE
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Escherichia coli ATCC 25922, Pseudomonas aeruginosa ATCC 27853;
      • Gram-positive bacteria: Staphylococcus aureus ATCC 29213, Enterococcus faecalis ATCC 29212.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03224 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03224.
    • Formula

    • C174H285N47O46
    • Absent Amino Acids

    • CDHMPRW
    • Common Amino Acids

    • K
    • Mass

    • 3771.46
    • PI

    • 10.3
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +7
    • Boman Index

    • -35.88
    • Hydrophobicity

    • -0.34
    • Aliphatic Index

    • 70
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 43.82
    • Polar Residues

    • 8

DRAMP03224

DRAMP03224 chydropathy plot
    • Function

    • Has antimicrobial activity. Probably acts by disturbing membrane Function
  • ·Literature 1
    • Title

    • Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae).
    • Reference

    • J Biol Chem. 2002 Mar 29;277(13):11208-11216.
    • Author

    • Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W.