General Information

    • DRAMP ID

    • DRAMP03557

    • Peptide Name

    • Granulysin (Lymphokine LAG-2; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • GNLY

    • Sequence

    • GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

    • Sequence Length

    • 83

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03557 helical wheel diagram

    • PDB ID

    • 1L9L resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP03557.

Physicochemical Information

    • Formula

    • C402H679N135O119S7

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • R

    • Mass

    • 9532.07

    • PI

    • 10.55

    • Basic Residues

    • 17

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +11

    • Boman Index

    • -248.11

    • Hydrophobicity

    • -0.615

    • Aliphatic Index

    • 71.57

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 106.46

    • Polar Residues

    • 27

DRAMP03557

DRAMP03557 chydropathy plot

Comments Information

    • Function

    • Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.

    • Tissue specificity

    • Expressed in natural killer and T-cells.

    • Induction

    • By T-cell growth factor and IL2/interleukin-2.

Literature Information

  • ·Literature 1

    • Title

    • An antimicrobial activity of cytolytic T cells mediated by granulysin.

    • Reference

    • Science. 1998 Oct 2;282(5386):121-125.

    • Author

    • Stenger S, Hanson DA, Teitelbaum R, Dewan P, Niazi KR, Froelich CJ, Ganz T, Thoma-Uszynski S, Melián A, Bogdan C, Porcelli SA, Bloom BR, Krensky AM, Modlin RL.
  • ·Literature 2

    • Title

    • Granulysin crystal structure and a structure-derived lytic mechanism.

    • Reference

    • J Mol Biol. 2003 Jan 10;325(2):355-365.

    • Author

    • Anderson DH, Sawaya MR, Cascio D, Ernst W, Modlin R, Krensky A, Eisenberg D.