General Information

    • DRAMP ID

    • DRAMP03559

    • Peptide Name

    • CXCL10 (Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the intercrine alpha (chemokine CxC) family

    • Gene

    • CXCL10

    • Sequence

    • VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

    • Sequence Length

    • 77

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Binds to CXCR3

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and beta structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03559 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03559.

Physicochemical Information

    • Formula

    • C375H652N114O108S5

    • Absent Amino Acids

    • DHWY

    • Common Amino Acids

    • KS

    • Mass

    • 8646.3

    • PI

    • 10.2

    • Basic Residues

    • 17

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +11

    • Boman Index

    • -173.96

    • Hydrophobicity

    • -0.47

    • Aliphatic Index

    • 89.87

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 250

    • Absorbance 280nm

    • 3.29

    • Polar Residues

    • 21

DRAMP03559

DRAMP03559 chydropathy plot

Comments Information

    • Function

    • Chemotactic for monocytes and T-lymphocytes.

Literature Information

  • ·Literature 1

    • Title

    • Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.

    • Reference

    • J Leukoc Biol. 2003 Sep;74(3):448-455.

    • Author

    • Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.
  • ·Literature 2

    • Title

    • Crystal structures of oligomeric forms of the IP-10/CXCL10 chemokine.

    • Reference

    • Structure. 2003 May;11(5):521-32.

    • Author

    • Swaminathan GJ, Holloway DE, Colvin RA, Campanella GK, Papageorgiou AC, Luster AD, Acharya KR.