• DRAMP ID

    • DRAMP03560
    • Peptide Name

    • CXC chemokine GRObeta [5-73] (Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the intercrine alpha (chemokine CxC) family
    • Gene

    • CXCL2
    • Sequence

    • TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
    • Sequence Length

    • 69
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic, Chemotactic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and beta structure
    • Structure Description

    • GRObeta [5-73] forms a dimer in solution that is architectured by a six-stranded antiparallel beta-sheet (residues 25 to 29, 39 to 44, 49 to 52) and a pair of helices (residues 58 to 68) with 2-fold symmetry, while the C terminus of the protein is disordered.(Ref.2)
    • Helical Wheel Diagram

    • DRAMP03560 helical wheel diagram
    • PDB ID

    • 1QNK resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP03560.
    • Formula

    • C325H561N97O95S6
    • Absent Amino Acids

    • DFWY
    • Common Amino Acids

    • K
    • Mass

    • 7539.98
    • PI

    • 9.75
    • Basic Residues

    • 13
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +10
    • Boman Index

    • -94.47
    • Hydrophobicity

    • -0.377
    • Aliphatic Index

    • 90.43
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 250
    • Absorbance 280nm

    • 3.68
    • Polar Residues

    • 21

DRAMP03560

DRAMP03560 chydropathy plot
    • Function

    • Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
    • PTM

    • The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.
    • Pharmaceutical use

    • GRO-beta(5-73) is available under the name Garnocestim as immunomodulator. It is used prior to hematopoietic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy induced cytopenias.
  • ·Literature 1
    • Title

    • Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
    • Reference

    • J Leukoc Biol. 2003 Sep;74(3):448-455.
    • Author

    • Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.
  • ·Literature 2
    • Title

    • Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.
    • Reference

    • J Mol Biol. 1999 Dec 17;294(5):1065-1072.
    • Author

    • Qian YQ, Johanson KO, McDevitt P.