• DRAMP ID

    • DRAMP03561
    • Peptide Name

    • CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the intercrine alpha (chemokine CxC) family
    • Gene

    • CXCL6
    • Sequence

    • GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
    • Sequence Length

    • 77
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Heparin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03561 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03561.
    • Formula

    • C369H630N104O104S4
    • Absent Amino Acids

    • HMWY
    • Common Amino Acids

    • KVL
    • Mass

    • 8315.94
    • PI

    • 9.75
    • Basic Residues

    • 13
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +8
    • Boman Index

    • -88.27
    • Hydrophobicity

    • -0.04
    • Aliphatic Index

    • 103.64
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 250
    • Absorbance 280nm

    • 3.29
    • Polar Residues

    • 21

DRAMP03561

DRAMP03561 chydropathy plot
    • Function

    • Chemotactic for neutrophil granulocytes.
  • ·Literature 1
    • Title

    • The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial.
    • Reference

    • Antimicrob Agents Chemother. 2008 Jul;52(7):2599-2607.
    • Author

    • Linge HM, Collin M, Nordenfelt P, Mörgelin M, Malmsten M, Egesten A.