• DRAMP ID

    • DRAMP03571
    • Peptide Name

    • LL-37
    • Source

    • Human lysosomes of polymorphonuclear leukocytes
    • Family

    • Belongs to the cathelicidin family
    • Gene

    • CAMP
    • Sequence

    • [LL-37, 37 aa]
    • Sequence Length

    • 37
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer
    • Target Organism

      • [Ref.29859288] Gram-negative bacteria:Escherichia coli (ATCC 25922)(MIC=25 ± 0 μg/ml);ESBL-producing Escherichia coli(MIC=33.3 ± 14.4μg/ml);NDM-1 producing Acinetobacter baumannii(MIC=20.8 ± 7.2 μg/ml);
      • Gram-positive bacteria:Staphylococcus aureus (ATCC 25923)(MIC=133.3 ± 57.7μg/ml);
      • Fungi:Candida albicans (ATCC 90028)(MIC>400μg/ml)
    • Hemolytic Activity

      • [Ref.29859288] 2.9 ± 0.7% Hemolysis at 500μg/ml against human red blood cell
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix
    • Structure Description

    • The peptide adopted 1 helices and 30 residues and a curved amphipathic helix-bend-helix motif spanning residues 2-31 followed by a disordered C-terminal tail. The helical bend is located between residues Gly-14 and Glu-16.
    • Helical Wheel Diagram

    • DRAMP03571 helical wheel diagram
    • PDB ID

    • 2K6O resolved by NMR
    • Predicted Structure

    • There is no predicted structure for DRAMP03571.
    • Formula

    • C205H340N60O53
    • Absent Amino Acids

    • ACHMWY
    • Common Amino Acids

    • K
    • Mass

    • 4493.32
    • PI

    • 10.61
    • Basic Residues

    • 11
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +6
    • Boman Index

    • -111
    • Hydrophobicity

    • -0.724
    • Aliphatic Index

    • 89.46
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 6

DRAMP03571

DRAMP03571 chydropathy plot
    • Function

    • Antibacterial activity against the Gram-positive and Gram-negative bacteria. Has hemolytic activity.
  • ·Literature 1
    • Title

    • Expression in Escherichia coli of novel recombinant hybrid antimicrobial peptide AL32-P113 with enhanced antimicrobial activity in vitro.
    • Reference

    • Gene. 2018 May 30. pii: S0378-1119(18)30617-6.
    • Author

    • Wanmakok M, Orrapin S, Intorasoot A, Intorasoot S.