General Information

    • DRAMP ID

    • DRAMP03645

    • Peptide Name

    • fowlicidin-2

    • Source

    • Gallus gallus

    • Family

    • Not found

    • Gene

    • CATHL2

    • Sequence

    • LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.27698732] Gram-positive bacterium:Staphylococcus aureus ATCC 29213 (MIC=4µM);
      • Gram-negative bacterium:Escherichia coli ATCC 25922 (MIC=1µM), Pseudomonas aeruginosa ATCC 27853 (MIC=4µM), Salmonella typhimurium C77-31 (MIC=2µM)

    • Hemolytic Activity

      • [Ref.27698732] 15% hemolysis at 10µM,40% hemolysis at 80µM,60% hemolysis at 200µM against human red blood cells.

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not foundn

    • Helical Wheel Diagram

    • DRAMP03645 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03645.

Physicochemical Information

    • Formula

    • C173H290N60O38

    • Absent Amino Acids

    • CDEHMNWY

    • Common Amino Acids

    • R

    • Mass

    • 3818.58

    • PI

    • 12.85

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +10

    • Boman Index

    • -99.91

    • Hydrophobicity

    • -0.428

    • Aliphatic Index

    • 82.19

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 7

DRAMP03645

DRAMP03645 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-negative bacteria and Gram-positive bacteria. Has hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • Recombinant expression and biological characterization of the antimicrobial peptide fowlicidin-2 in Pichia pastoris.

    • Reference

    • Exp Ther Med. 2016 Oct;12(4):2324-2330.

    • Author

    • Xing LW, Tian SX, Gao W, Yang N, Qu P, Liu D, Jiao J, Wang J, Feng XJ.