General Information

    • DRAMP ID

    • DRAMP03830

    • Peptide Name

    • Palustrin-2ISb + 3aa

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHK

    • Sequence Length

    • 39

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=6.3 µM);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=6.3 µM), S. aureus (MRSA) (MIC=100 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys23 and Cys29.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03830 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C195H320N54O52S2

    • Absent Amino Acids

    • MQ

    • Common Amino Acids

    • K

    • Mass

    • 4317.14

    • PI

    • 9.63

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -44.54

    • Hydrophobicity

    • -0.182

    • Aliphatic Index

    • 94.87

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 187.24

    • Polar Residues

    • 12

DRAMP03830

DRAMP03830 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and structure-activity relationship of an antimicrobial peptide of the palustrin-3 family isolated from the skin of the endangered frog Odorrana ishikawae.

    • Reference

    • Peptides. 2011 Oct;32(10):2052-2057.

    • Author

    • Iwakoshi-Ukena E, Okada G, Okimoto A, Fujii T, Sumida M, Ukena K.