• DRAMP ID

    • DRAMP03830
    • Peptide Name

    • Palustrin-2ISb + 3aa
    • Source

    • Synthetic construct
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHK
    • Sequence Length

    • 39
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Synthetic
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=6.3 µM);
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMIC=6.3 µM
        S. aureus (MRSA)MIC=100 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys23 and Cys29.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03830 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03830.
    • Formula

    • C195H320N54O52S2
    • Absent Amino Acids

    • MQ
    • Common Amino Acids

    • K
    • Mass

    • 4317.14
    • PI

    • 9.63
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +6
    • Boman Index

    • -44.54
    • Hydrophobicity

    • -0.182
    • Aliphatic Index

    • 94.87
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7115
    • Absorbance 280nm

    • 187.24
    • Polar Residues

    • 12

DRAMP03830

DRAMP03830 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Identification and structure-activity relationship of an antimicrobial peptide of the palustrin-3 family isolated from the skin of the endangered frog Odorrana ishikawae.
    • Reference

    • Peptides. 2011 Oct;32(10):2052-2057.
    • Author

    • Iwakoshi-Ukena E, Okada G, Okimoto A, Fujii T, Sumida M, Ukena K.