• DRAMP ID

    • DRAMP04815
    • Sequence

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
    • Sequence Length

    • 36
    • Sequence Name

    • Sequence 6 from Patent US 20030092612
    • Source

    • Silk moth
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2003-5-15
    • Patent Title

    • Use of antimicrobial peptides as preservatives in ophthalmic preparations, including solutions, emulsions, and suspensions.
    • Abstract

    • Methods for preserving ophthalmic compositions are disclosed. In one embodiment, such compositions include a liquid medium and an antimicrobial component which is preferably substantially non-oxidative. Compositions which include a liquid medium and antimicrobial peptide magainins, present in an amount effective as a preservative, are also disclosed. Preserved compositions useful for administering a therapeutic component to the eyes or caring for contact lenses are also included within the scope of the present invention.