Sequence Information

    • DRAMP ID

    • DRAMP18167

    • Name

    • Ruminococcin C (Bacteriocin)

    • Sequence

    • MRNDVLTLTNPMEEKELEQILGGGNGVLKTISHECNMNTWQFLFTCC

    • Description

    • Ruminococcus gnavus E1

    • Activity

    • Antibacterial

    • Target Organism

      • No MICs found on DRAMP database

    • Reference

      • Ruminococcin C, a new anti-Clostridium perfringens bacteriocin produced in the gut by the commensal bacterium Ruminococcus gnavus E1. (PMID: 21586310)

Clinical Information

    • Medical use

    • Gastrointestinal tract infections; Stomach and intestine infections (Rat model; In-vivo)

    • Company

    • Unknown

    • Stage of Development

    • Preclinical

    • Comments

    • No more comments

    • Clinical Trials