• DRAMP ID

    • DRAMP18440
    • Peptide Name

    • WB Piscidin 5 (fish, animals)
    • Source

    • Morone chrysops
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP
    • Sequence Length

    • 46
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18440 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18440.
    • Formula

    • C255H398N84O56
    • Absent Amino Acids

    • CDEMNT
    • Common Amino Acids

    • R
    • Mass

    • 5536.49
    • PI

    • 11.84
    • Basic Residues

    • 14
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +14
    • Boman Index

    • -12420
    • Hydrophobicity

    • -0.539
    • Aliphatic Index

    • 78.48
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 12950
    • Absorbance 280nm

    • 287.78
    • Polar Residues

    • 12

DRAMP18440

DRAMP18440 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes
    • Reference

    • PLoS One. 2016 Aug 23;11(8):e0159423.
    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ