General Information

    • DRAMP ID

    • DRAMP18496

    • Peptide Name

    • rNZ2114

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KRGFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • [Ref.23624708]Gram-positive bacteria: Staphylococcus aureus(MSSA MIC=0.028 μM;MRSA MIC=0.90μM)

    • Hemolytic Activity

      • [Ref.23624708]<0.1% hemolysis upto 128μg/ml against human red blood cells.

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18496 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18496.

Physicochemical Information

    • Formula

    • C203H304N62O56S6

    • Absent Amino Acids

    • MQT

    • Common Amino Acids

    • G

    • Mass

    • 4701.39

    • PI

    • 9.04

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +7

    • Boman Index

    • -8127

    • Hydrophobicity

    • -0.841

    • Aliphatic Index

    • 27.86

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 252.32

    • Polar Residues

    • 21

DRAMP18496

DRAMP18496 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against Gram-positive bacteria. Weak hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • High expression of a plectasin-derived peptide NZ2114 in Pichia pastoris and its pharmacodynamics, postantibiotic and synergy against Staphylococcus aureus.

    • Reference

    • Appl Microbiol Biotechnol

    • Author

    • Yong ZhangDa TengRuoyu MaoXiumin WangDi XiXiaoyuan HuJianhua Wang