• • DRAMP ID

  • DRAMP18710

• • Peptide Name

  • Royalisin (Insects, arthropods, invertebrates, animals)

• • Source

  • Apis mellifera L. (royal jelly honeybee)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF

• • Sequence Length

  • 51

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • [Ref.2358464] Gram-positive bacteria: Bifidobacterium adolescentis ATCC15703 (MIC=15 µM at concentration of 1%, MIC=43 µM at concentration of 10%, MIC=59 µM at concentration of 100%), Bifidobacterium bifidum ATCC15606 (MIC=91 µM at concentration of 100%), Bifidobacterium breve ATCC15700 (MIC=67 µM at concentration of 10%, MIC=87 µM at concentration of 100%), Bifidobacterium infantis ATCC15697 (MIC=20 µM at concentration of 10%, MIC=71 µM at concentration of 100%), Bifidobacterium longum ATCC15707 (MIC=29 µM at concentration of 1%, MIC=81 µM at concentration of 10%, MIC=81 µM at concentration of 100%), Clostridium perfringens ATCC13124 (MIC=75 µM at concentration of 100%), Corynebacterium pyogenes (MIC=31 µM at concentration of 10%, MIC=96 µM at concentration of 100%), Eubacterium aerofacience (MIC=17 µM at concentration of 100%), Lactobacillus acidophilus ATCC314 (MIC=44 µM at concentration of 100%), Lactobacillus acidophilus ATCC4356 (MIC=47 µM at concentration of 100%), Lactobacillus bulgaricus ATCC11841 (MIC=21 µM at concentration of 1%, MIC=87 µM at concentration of 10%, MIC=84 µM at concentration of 100%), Lactobacillus helveticus ss. jugurti (MIC=33 µM at concentration of 1%, MIC=90 µM at concentration of 10%, MIC=72 µM at concentration of 100%), Lactobacillus lactis ATCC7830 (MIC=59 µM at concentration of 1%, MIC=90 µM at concentration of 10%, MIC=88 µM at concentration of 100%), Lactobacillus leichmannii ATCC7830 (MIC=14 µM at concentration of 1%, MIC=88 µM at concentration of 10%, MIC=89 µM at concentration of 100%), Leuconostoc cremoris ATCC19254 (MIC=16 µM at concentration of 1%, MIC=84 µM at concentration of 10%, MIC=88 µM at concentration of 100%), Stapjylococcus aureus SC-D (MIC=17 µM at concentration of 1%, MIC=22 µM at concentration of 10%, MIC=82 µM at concentration of 100%), Streptococcus cremoris SCR-812 (MIC=10 µM at concentration of 1%, MIC=18 µM at concentration of 10%, MIC=83 µM at concentration of 100%), Streptococcus thermophilus ATCC19258 (MIC=9 µM at concentration of 1%, MIC=14 µM at concentration of 10%, MIC=86 µM at concentration of 100%).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Bridge

• • Structure Description

  • High content of cysteine residues and a compact structure owing to intramolecular disulfide cross-linking.

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP18710.

DRAMP18710

• • Function

  • Antibacteria activity against Gram-positive bacteria.

• ·Literature 1

• • Title

  • A potent antibacterial protein in royal jelly. Purification and determination of the primary structure of royalisin.

• • Pubmed ID

  • 2358464

• • Reference

  • J. Biol. Chem. 1990; 265:11333-11337

• • Author

  • Fujiwara S, Imai J, Fujiwara M, Yaeshima T, Kaishima T, Kobayashi K.