General Information

    • DRAMP ID

    • DRAMP18721

    • Peptide Name

    • Hinnavin I (Hin I; insects, arthropods, invertebrates, animals)

    • Source

    • Artogeia rapae (cabbage butterfly)

    • Family

    • Belongs to the Cecropins family.

    • Gene

    • Not found

    • Sequence

    • GWKIGKKLEHHGQNIRDGLISAGPAVFAVGQAATIYAAAK

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.9339895] Gram-positive bacteria: Bacillus subtilis (Inhibition zone=3.0 mm), Bacillus megaterium Bm11 (Inhibition zone=5.0 mm), Bacillus thuringiensis (Inhibition zone=3.0 mm);
      • Gram-negative bacteria: Escherichia coli (Inhibition zone=7.0 mm), Escherichia coli D21 (Inhibition zone=7.1 mm), Enterobacter cloacae (Inhibition zone=6.0 mm);
      • Fungi: Candida albicans (Inhibition zone=3.0 mm), Aspergillus niger (Inhibition zone=3.0 mm).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membranes

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18721 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18721.

Physicochemical Information

    • Formula

    • C188H299N55O51

    • Absent Amino Acids

    • CM

    • Common Amino Acids

    • A

    • Mass

    • 4145.78

    • PI

    • 9.82

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +5

    • Boman Index

    • -2277

    • Hydrophobicity

    • -0.013

    • Aliphatic Index

    • 93

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 179.23

    • Polar Residues

    • 10

DRAMP18721

DRAMP18721 chydropathy plot

Comments Information

    • Function

    • Hinnavin 1 is heat stable; its activity is retained after 60 min incubation at 100 DC, being effective against Gram negative and/or Gram positive bacteria. Hinnavin I and lysozyme 2 showed a powerful synergistic effect on the inhibition of bacterial growth.

Literature Information

  • ·Literature 1

    • Title

    • Hinnavin I, an antibacterial peptide from cabbage butterfly, Artogeia rapae.

    • Reference

    • Mol Cells. 1997 Aug 31;7(4):509-13

    • Author

    • Bang IS, Son SY, Yoe SM.