General Information

    • DRAMP ID

    • DRAMP20788

    • Peptide Name

    • Bovine neutrophil Beta-defensin 3 (BNBD-3; cattle, ruminant, mammals; animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB3

    • Sequence

    • QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization of a N-terminal glutamine

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys24 and Cys53, Cys31 and Cys46, Cys36 and Cys54

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20788 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20788.

Physicochemical Information

    • Formula

    • C204H336N74O51S6

    • Absent Amino Acids

    • ADELMY

    • Common Amino Acids

    • R

    • Mass

    • 4833.74

    • PI

    • 11.2

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +10

    • Boman Index

    • -11257

    • Hydrophobicity

    • -0.393

    • Aliphatic Index

    • 57.86

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 143.29

    • Polar Residues

    • 17

DRAMP20788

DRAMP20788 chydropathy plot

Comments Information

    • Function

    • Antibacterial against Escherichia coli ML35 and Staphylococcus aureus 502A.

    • Tissue specificity

    • Neutrophilic granules.

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J. Biol. Chem. 1993; 268:6641-6648.

    • Author

    • Selsted ME, Tang Y-Q, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.