General Information

    • DRAMP ID

    • DRAMP20789

    • Peptide Name

    • Bovine neutrophil Beta-defensin 12 (BNBD-12; cattle, ruminant, mammals; animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB12

    • Sequence

    • GPLSCGRNGGVCIPIRCPVPNRQIGTCFGRPVKCCRSW

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys34, Cys12 and Cys27, Cys17 and Cys35

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20789 helical wheel diagram

    • PDB ID

    • 1BNB resolved by NMR

    • Predicted Structure

    • There is no predicted structure for DRAMP20789.

Physicochemical Information

    • Formula

    • C173H284N58O45S6

    • Absent Amino Acids

    • ADEHMY

    • Common Amino Acids

    • CG

    • Mass

    • 4088.88

    • PI

    • 9.57

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -5791

    • Hydrophobicity

    • -0.074

    • Aliphatic Index

    • 63.95

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 17

DRAMP20789

DRAMP20789 chydropathy plot

Comments Information

    • Function

    • Antibacterial against Escherichia coli ML35 and Staphylococcus aureus 511A.

    • Tissue specificity

    • Neutrophilic granules.

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J. Biol. Chem. 1993; 268:6641-6648.

    • Author

    • Selsted ME, Tang Y-Q, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.