• DRAMP ID

    • DRAMP20790
    • Peptide Name

    • Cecropin B (Insects, arthropods, invertebrates, animals)
    • Source

    • Hyalophora cecropia (Cecropia moth)
    • Family

    • Belongs to the cecropin family.
    • Gene

    • Not found
    • Sequence

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.7019715] Gram-positive bacteria: Bacillus megaterium Bm11 (Inhibition zone=10.0 mm), Bacillus subtilis (Inhibition zone=7.2 mm);
      • Gram-negative bacteria: Escherichia coli K12 D31 (Inhibition zone=12.5 mm), Serratia marcescens Db1108 (Inhibition zone=7.2 mm), Pseudomonas aeruginosa OT97 (Inhibition zone=9.7 mm), Xenorhabdus nematophilus Xn21 (Inhibition zone=10.0 mm).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation (Leu35) PMID:3857578
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP20790 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP20790.
    • Formula

    • Absent Amino Acids

    • Common Amino Acids

    • Mass

    • 3892.75
    • PI

    • 10.73
    • Basic Residues

    • Acidic Residues

    • Hydrophobic Residues

    • Net Charge

    • Boman Index

    • 0
    • Hydrophobicity

    • 0
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:
      • Yeast:
      • E.coli:
    • Extinction Coefficient Cystines

    • Absorbance 280nm

    • 0
    • Polar Residues

DRAMP20790

DRAMP20790 chydropathy plot
    • Function

    • Antibacterial activity against several Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Sequence and specificity of two antibacterial proteins involved in insect immunity
    • Reference

    • Nature. 1981 Jul 16;292(5820):246-8.
    • Author

    • Steiner H, Hultmark D, Engstr?m A, Bennich H, Boman HG.