General Information

    • DRAMP ID

    • DRAMP20798

    • Peptide Name

    • Lingual antimicrobial peptide (LAP, beta defensin, cattle, ruminant, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family. LAP/TAP subfamily.

    • Gene

    • LAP

    • Sequence

    • QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.7886453] Gram-positive bacterium: Staphylococcus aureus 29213 (MIC=63-125 μg/ml);
      • Gram-negative bacteria: Escherichia coli D31 (MIC=16-32 μg/ml), Pseudomonas aeruginosa 27853 (MIC=63-125 μg/ml);
      • Fungi: Candida albicans 14053 (MIC=32-63 μg/ml), Candida tropicalis 13803 (MIC=16-32 μg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys38, Cys16 and Cys31, Cys21 and Cys39.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20798 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20798.

Physicochemical Information

    • Formula

    • C186H332N72O53S7

    • Absent Amino Acids

    • DEFHWY

    • Common Amino Acids

    • R

    • Mass

    • 4649.55

    • PI

    • 10.85

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +10

    • Boman Index

    • -12096

    • Hydrophobicity

    • -0.569

    • Aliphatic Index

    • 60.24

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.15

    • Polar Residues

    • 17

DRAMP20798

DRAMP20798 chydropathy plot

Comments Information

    • Function

    • Shows a broad spectrum of antibacterial and antifungal activities.

    • Tissue specificity

    • In many of the exposed epithelial surfaces including conjunctivae, bronchi, colon, urinary tract and trachea.

    • Developmental stage

    • Not found in fetus.

Literature Information

  • ·Literature 1

    • Title

    • Epithelial antibiotics induced at sites of inflammation.

    • Reference

    • Science. 1995 Mar 17; 267(5204):1645-1648

    • Author

    • Schonwetter BS., Stolzenberg ED., Zasloff MA.