• DRAMP ID

    • DRAMP20801
    • Peptide Name

    • Mussel Defensin MGD-1 (Mediterranean mussel defensin 1; mollusca/molluscs/mollusks, invertebrates, animals)
    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)
    • Family

    • Belongs to the invertebrate defensin family. Type 2 subfamily.
    • Gene

    • FH3
    • Sequence

    • GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRC
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.8925841] Gram-positive bacteria: Micrococcus luteus (MIC=0.08 μg/ml);
      • Gram-negative bacteria: Escherichia coli (MIC=6.4 μg/ml), Vibrio alginolyticus (MIC=6.4 μg/ml), Vibrio splendidus (MIC=1.6 μg/ml), Vibrio P1 (MIC=6.4 μg/ml).
    • Hemolytic Activity

      • [Ref.8925841] The plasma is capable of causing 20% of the total hemolysis.
    • Cytotoxicity

      • [Ref.8925841] The protozoan P. marinus is not killed by pure peptide, even at a concentration of 16 μg/ml.
    • Binding Target

    • Cell membranes
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys25, Cys10 and Cys33, Cys14 and Cys35, Cys21 and Cys38. Hydroxylation of Trp28 (3hydroxytryptophan)
    • Stereochemistry

    • L
    • Structure

    • Combine Helix and Beta structure
    • Structure Description

    • The signature of MGD-1 is that of the arthropod defensins which range in length from 34 to 51 amino acid residues with 6 conserved cysteines engaged in three intramolecular disulfide bridges. They are characterized by the presence of a flexible amino-terminal loop, a central amphipathic
    • Helical Wheel Diagram

    • DRAMP20801 helical wheel diagram
    • PDB ID

    • 1FJN resolved by NMR
    • Predicted Structure

    • There is no predicted structure for DRAMP20801.
    • Formula

    • Absent Amino Acids

    • Common Amino Acids

    • Mass

    • 4291.94
    • PI

    • 8.94
    • Basic Residues

    • Acidic Residues

    • Hydrophobic Residues

    • Net Charge

    • Boman Index

    • 0
    • Hydrophobicity

    • 0
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:
      • Yeast:
      • E.coli:
    • Extinction Coefficient Cystines

    • Absorbance 280nm

    • 0
    • Polar Residues

DRAMP20801

DRAMP20801 chydropathy plot
    • Function

    • Active against both Gram-positive and Gram-negative bacteria but is not cytotoxic towards human erythrocytes or protozoa.
  • ·Literature 1
    • Title

    • A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis)
    • Reference

    • Eur J Biochem. 1996 Aug 15;240(1):302-6.
    • Author

    • Hubert F, Noel T, Roch P.