General Information

    • DRAMP ID

    • DRAMP20807

    • Peptide Name

    • A1P394-428

    • Source

    • American alligator

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP

    • Sequence Length

    • 35

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.27542832] Gram-positive bacteria:Staphylococcus aureus ATCC BAA-1718 (EC50=36.5μg/ml), Staphylococcus aureus ATCC 33592 (EC50=2.68μg/ml);
      • Gram-negative bacteria:Escherichia coli ATCC 4157 (EC50=9.2μg/ml), Escherichia coli ATCC 51659 (EC50=2.51μg/ml), Pseudomonas aeruginosa PAO1 (EC50=38.6μg/ml), Acinetobacter baumannii ATCC 9955 (EC50=24.0μg/ml), Acinetobacter baumannii ATCC BAA-1794 (EC50=2.36μg/ml)

    • Hemolytic Activity

      • [Ref.27542832] Not hemolytic to sheep red blood cells.

    • Cytotoxicity

      • [Ref.27542832] The cell proliferation of A549 human lung epithelial cells is 170%, 180%, 182%, 180% and 180% at peptide concentrations of 1 μg/ml, 10 μg/ml, 25 μg/ml, 50 μg/ml, 100 μg/ml

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix,beta-sheet,beta-turn,random coil

    • Structure Description

    • A1P is primarily random coil with two anti-parallel

    • Helical Wheel Diagram

    • DRAMP20807 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20807.

Physicochemical Information

    • Formula

    • C194H308N50O44S2

    • Absent Amino Acids

    • CHQY

    • Common Amino Acids

    • P

    • Mass

    • 4109.01

    • PI

    • 11

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -3583

    • Hydrophobicity

    • 0.017

    • Aliphatic Index

    • 94.57

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 161.76

    • Polar Residues

    • 5

DRAMP20807

DRAMP20807 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-negative and Gram-positive bacteria

Literature Information

  • ·Literature 1

    • Title

    • Peptides from American alligator plasma are antimicrobial against multi-drug resistant bacterial pathogens including Acinetobacter baumannii

    • Reference

    • BMC Microbiol. 2016 Aug 19;16(1):189.

    • Author

    • Barksdale SM, Hrifko EJ, Chung EM, van Hoek ML.