General Information

    • DRAMP ID

    • DRAMP20863

    • Peptide Name

    • rtCATH2(1-40)

    • Source

    • Synthetic construct

    • Family

    • Derived from Cathelicidins

    • Gene

    • Not found

    • Sequence

    • KIRTRRGKDSGGPKMGRKNSKGGWRGRPGSGSRPGFGSGI

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.27818338]Gram-negative bacteria:Escherichia coli (ATCC 25922)(MIC=4μM);A. salmonicida (ATCC 33658)(MIC=8-4μM);Y. ruckeri (NCIMB 1315)(MIC=16μM);V. anguillarum (ATCC 43305 With addition of 2% NaCl)(MIC>32μM);A. hydrophila (ATCC 7966)(MIC>32μM);
      • Gram-positive bacteria:Staphylococcus aureus (ATCC 25923)(MIC=16-8μM);L. garvieae (ATCC 49156)(MIC=16-8μM)

    • Hemolytic Activity

      • [Ref.27818338] No hemolytic activity to human;No hemolytic activity to trout

    • Cytotoxicity

      • [Ref.27818338] The cell viability of RTG-2 cells is 112.5%, 105%, 107%, 94% at peptide concentrations of 0.25, 1, 4, and 8 μM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Unconventional feature

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20863 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20863.

Physicochemical Information

    • Formula

    • C175H296N68O50S

    • Absent Amino Acids

    • ACEHLQVY

    • Common Amino Acids

    • G

    • Mass

    • 4184.76

    • PI

    • 12.4

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +11

    • Boman Index

    • -13834

    • Hydrophobicity

    • -1.488

    • Aliphatic Index

    • 19.5

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 141.03

    • Polar Residues

    • 19

DRAMP20863

DRAMP20863 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-positive and Gram-negative bacteria. The peptides inhibit the growth of V. anguillarum or A. hydrophila (MIC >32

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial and host cell-directed activities of Gly/Ser-rich peptides from salmonid cathelicidins.

    • Reference

    • Fish Shellfish Immunol. 2016 Dec;59:456-468.

    • Author

    • D'Este F, Benincasa M, Cannone G, Furlan M, Scarsini M, Volpatti D, Gennaro R, Tossi A, Skerlavaj B, Scocchi M.