General Information

    • DRAMP ID

    • DRAMP20934

    • Peptide Name

    • Lucilin Peptide

    • Source

    • L. eximia maggots

    • Family

    • Cecropins

    • Gene

    • ATGAATTTTAATAAATTTTT

    • Sequence

    • MNFNKFFVLFALIMVAVVGQSEAGWLKKLGKKIERVGQHTRDATIQTIGVAQQAVNVAATLKG

    • Sequence Length

    • 63

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-, Wound-healing

    • Target Organism

      • [Ref.29890152] Gram-negative bacteria: Escherichia coli DH10B (MIC=7.8 μg/ml; MBC=7.8 μg/ml), Escherichia coli ESBL (MIC=15.6 μg/ml; MBC=15.6 μg/ml), Enterobacter cloacae (MIC=125 μg/ml; MBC=125 μg/ml)

    • Hemolytic Activity

      • [Ref.29890152]Hemolysis 0% at 0.24 μg/ml, hemolysis 0% at 0.49 μg/ml, hemolysis 0% at 0.98 μg/ml, hemolysis 0% at 1.95 μg/ml, hemolysis 0% at 3.91 μg/ml, hemolysis 0% at 7.81 μg/ml, hemolysis 0% at 15.60 μg/ml, hemolysis 0% at 31.00 μg/ml, hemolysis 0% at 63.00 μg/ml, hemolysis 0% at 125.00 μg/ml, hemolysis 0% at 250.00 μg/ml against human red blood cell

    • Cytotoxicity

      • [Ref.29890152] The peptide did not show cytotoxic activities against Vero cells.
      • The peptide showed a toxic concentration from 62.5 μg/ml with IC50 of 58.30 μg/ml against PBMCs

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP20934 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP20934.

Physicochemical Information

    • Formula

    • C311H508N86O83S2

    • Absent Amino Acids

    • CPY

    • Common Amino Acids

    • AV

    • Mass

    • 6844.1

    • PI

    • 10.29

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +6

    • Boman Index

    • -3577

    • Hydrophobicity

    • 0.302

    • Aliphatic Index

    • 105.24

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 88.71

    • Polar Residues

    • 14

DRAMP20934

DRAMP20934 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-negative bacteria. Immunomodulatory activity. Decreasing the TNF-alpha production in PBMCs and inducing cellular migration in human keratinocytes.

Literature Information

  • ·Literature 1

    • Title

    • Identification, Characterization, Immunolocalization, and Biological Activity of Lucilin Peptide.

    • Reference

    • Bioorg Med Chem Lett. 2012 Jun 15;22(12):4185-8.

    • Author

    • Téllez GA, Zapata JA, Toro LJ, Henao DC, Bedoya JP, Rivera JD, Trujillo JV, Rivas-Santiago B, Hoyos RO, Castano JC.