• DRAMP ID

    • DRAMP21455
    • Peptide Name

    • PLP2 (Insects, animals)
    • Source

    • Odontomachus monticola (Trap-jaw ant)
    • Family

    • Belongs to the formicidae venom precursor-01 superfamily.
    • Gene

    • Not found
    • Sequence

    • GWGSIFKTVGKMIAKAAVKAAPEAISAMASQNE
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • [Ref.30658410] Gram-positive bacteria:Staphylococcus aureus (MIC<6.2μM);
      • Gram-negative bacteria:Escherichia coli (MIC<6.2μM);
      • Fungi:Saccharomyces cerevisiae (MIC<50μM)
    • Hemolytic Activity

      • [Ref.30658410] 10.4% hemolysis at 50 μM against rat blood cells
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • α-helix predicted by Proteus
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP21455 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP21455.
    • Formula

    • C149H244N40O44S2
    • Absent Amino Acids

    • CDHLRY
    • Common Amino Acids

    • A
    • Mass

    • 3363.94
    • PI

    • 9.53
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +2
    • Boman Index

    • -1062
    • Hydrophobicity

    • 0.197
    • Aliphatic Index

    • 77.27
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 171.88
    • Polar Residues

    • 8

DRAMP21455

DRAMP21455 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-nagetive bacteria. Antifungal activity against Saccharomyces cerevisiae.
  • ·Literature 1
    • Title

    • Mass Spectrometry Analysis and Biological Characterization of the Predatory Ant Odontomachus monticola Venom and Venom Sac Components
    • Reference

    • Toxins (Basel). 2019 Jan; 11(1): 50. Published online 2019 Jan 17. doi: 10.3390/toxins11010050
    • Author

    • Naoki Tani, Kohei Kazuma, Yukio Ohtsuka, Yasushi Shigeri, Keiichi Masuko, Katsuhiro Konno, Hidetoshi Inagaki