• DRAMP ID

    • DRAMP21456
    • Peptide Name

    • PLP3 (Insects, animals)
    • Source

    • Odontomachus monticola (Trap-jaw ant)
    • Family

    • Belongs to the formicidae venom precursor-01 superfamily.
    • Gene

    • Not found
    • Sequence

    • KIKWGKIFKKGGKLIGKTALEAAANAAASEAISAMASQNE
    • Sequence Length

    • 40
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • [Ref.30658410] Gram-positive bacteria:Staphylococcus aureus (MIC<25μM);
      • Gram-negative bacteria:Escherichia coli (MIC<3.1μM);
      • Fungi:Saccharomyces cerevisiae (MIC<50μM)
    • Hemolytic Activity

      • [Ref.30658410] 0% hemolysis at 50 μM against rat blood cells
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • α-helix predicted by Proteus
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP21456 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP21456.
    • Formula

    • C182H305N51O54S
    • Absent Amino Acids

    • CDHPRVY
    • Common Amino Acids

    • A
    • Mass

    • 4103.79
    • PI

    • 9.88
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +4
    • Boman Index

    • -3183
    • Hydrophobicity

    • -0.14
    • Aliphatic Index

    • 83.5
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 141.03
    • Polar Residues

    • 10

DRAMP21456

DRAMP21456 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-nagetive bacteria. Antifungal activity against Saccharomyces cerevisiae.
  • ·Literature 1
    • Title

    • Mass Spectrometry Analysis and Biological Characterization of the Predatory Ant Odontomachus monticola Venom and Venom Sac Components
    • Reference

    • Toxins (Basel). 2019 Jan; 11(1): 50. Published online 2019 Jan 17. doi: 10.3390/toxins11010050
    • Author

    • Naoki Tani, Kohei Kazuma, Yukio Ohtsuka, Yasushi Shigeri, Keiichi Masuko, Katsuhiro Konno, Hidetoshi Inagaki