• DRAMP ID

    • DRAMP29238
    • Peptide Name

    • NYBSP-4
    • Sequence

    • TIEEQⓏKTFLDKⓍNHEAEDLFYQⓍSLAⓍWN
    • Sequence Length

    • 30
    • Original Sequence

    • TIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    • Source

    • Synthetic construct
    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)
    • Comments

    • Mechanism of action:Proteolytic stability of NYBSP-4 in human plasma(half-life (T1/2) of NYBSP-4 was >289 min).The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection.
    • Target Organism

      • [Ref.33310780]Virus:
      • SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=1.97 ± 0.14 μM);Inhibition of infection in A549/ACE2 cells(IC50=2.8 ± 0.08 μM);Inhibition of virus-induced cytopathic effect (CPE) in Vero E6 cells(IC100=33 μM);
      • VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>26.6 μM);Inhibition of infection in A549/ACE2 cells(IC50>26.6 μM).
    • Hemolytic Activity

      • No hemolytic activity information found.
    • Cytotoxicity

      • [Ref.33310780]HT1080/ACE2 cells:CC50>26.6 μM(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>26.6 μM(Less than 10% toxicity at this dose).
    • Linear/Cyclic

    • Cyclic (Stapled)
    • N-terminal Modification

    • Acylation
    • C-terminal Modification

    • Amidation
    • Special Amino Acid and Stapling Position

    • ①The Ⓧ (position: 13,24 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.②The Ⓩ (position: 6) indicates 2-(7'-octenyl) alanine in the R configuration.③ Ⓩ(6) and Ⓧ(13), Ⓧ(24) and Ⓧ(28) are cross-linked by hydrocarbon stapling.
    • Stereochemistry

    • L
    • Secondary Structure

    • 80% α-helical content in 10 mM phosphate-buffered saline (PBS)
    • Structure Description

    • No other descriptive information about the structure found in the literature
    • Helical Wheel Diagram

    • DRAMP29238 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP29238.
    • Formula

    • C161H233N39O53
    • Absent Amino Acids

    • CGMPRV
    • Common Amino Acids

    • E
    • Mass

    • 3562.85
    • PI

    • 4.35
    • Basic Residues

    • 3
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 11
    • Hydrophobicity

    • -74.33
    • Polar Residues

    • 8

DRAMP29238

  • Literature 1
    • Title

    • Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro.
    • Reference

    • mBio. 2020 Dec 11;11(6):e02451-20.
    • Author

    • Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK.