"DRAMP_ID"	"Sequence"	"Sequence_Length"	"Name"	"Swiss_Prot_Entry"	"Family"	"Gene"	"Source"	"Activity"	"Protein_existence"	"Structure_Description"	"Structure"	"PDB_ID"	"Comments"	"Target_Organism"	"Hemolytic_activity"	"half_life"	"Type"	"Assay"	"Linear/Cyclic/Branched"	"N-terminal_Modification"	"C-terminal_Modification"	"Other_Modifications"	"Stereochemistry"	"Cytotoxicity"	"Binding_Traget"	"Pubmed_ID"	"Reference"	"Author"	"Title"
"DRAMP29839"	"RRWQWR"	"6"	"Lfc2"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=15 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=15 µM), Bacillus subtilis(LD99=1.9 µM)."	"None of the peptides are hemolytic"	"Degraded quickly with half-lives of less than 0.5 h and are completely gone after 2 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29840"	"RRWQWR"	"6"	"Lfc3"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=120 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99>120 µM), Bacillus subtilis(LD99=60 µM)."	"None of the peptides are hemolytic"	"Have half-lives of about 1 h, still almost fully degraded after 2 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Acetylation"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29841"	"RRWQWR"	"6"	"Lfc4"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=15 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=60 µM), Bacillus subtilis(LD99=3.8 µM)."	"None of the peptides are hemolytic"	"Have half-lives of ∼1.5 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Acetylation"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29842"	"RRWQWR"	"6"	"Lfc5"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=7.5 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=7.5 µM), Bacillus subtilis(LD99=1.9 µM)."	"None of the peptides are hemolytic"	"More than 70% of peptides remain intact after 6.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization (N termini to C termini)"	"Cyclization (C termini to N termini)"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29843"	"CRRWQWRC"	"8"	"Lfc6"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=15 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=3.8 µM), Bacillus subtilis(LD99=0.9 µM)."	"None of the peptides are hemolytic"	"Have half-lives of ∼1.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization(Cys1 and Cys8)"	"Amidation and Cyclization(Cys1 and Cys8)"	"Disulfide bond between Cys1 and Cys8."	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29844"	"RRWQWRMKKLG"	"11"	"Lfc7"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=15 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=7.5 µM), Bacillus subtilis(LD99=0.9 µM)."	"None of the peptides are hemolytic"	"Approach 0% intact peptide remaining after 6.5 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29845"	"RRWQWRMKKLG"	"11"	"Lfc8"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=3.8 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=15 µM), Bacillus subtilis(LD99≦0.45 µM)."	"None of the peptides are hemolytic"	"Have half-lives of ∼1.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization (N termini to C termini)"	"Cyclization (C termini to N termini)"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29846"	"CRRWQWRMKKLGC"	"13"	"Lfc9"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=1.9 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99≦0.45 µM), Bacillus subtilis(LD99≦0.45 µM)."	"None of the peptides are hemolytic"	"Have half-lives of ∼1.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization(Cys1 and Cys13)"	"Amidation and Cyclization(Cys1 and Cys13)"	"Disulfide bond between Cys1 and Cys13."	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29847"	"RRWWRF"	"6"	"Com1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=60 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=7.5 µM), Bacillus subtilis(LD99=1.9 µM)."	"None of the peptides are hemolytic"	"Degraded quickly with half-lives of less than 0.5 h and are completely gone after 2 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29848"	"RRWWRF"	"6"	"Com2"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=30 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=30 µM), Bacillus subtilis(LD99=0.9 µM)."	"None of the peptides are hemolytic"	"Degraded quickly with half-lives of less than 0.5 h and are completely gone after 2 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29849"	"RRWWRF"	"6"	"Com3"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=120 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=30 µM), Bacillus subtilis(LD99=7.5 µM)."	"None of the peptides are hemolytic"	"Have half-lives of about 1 h, still almost fully degraded after 2 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Acetylation"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29850"	"RRWWRF"	"6"	"Com4"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=7.5µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=7.5 µM), Bacillus subtilis(LD99=0.9 µM)."	"None of the peptides are hemolytic"	"Have half-lives of ∼1.5 h."	"Human Serum"	"RP-HPLC"	"Linear"	"Acetylation"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29851"	"CRRWWRFC"	"8"	"Com6"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=3.8 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=0.9 µM), Bacillus subtilis(LD99=0.9 µM)."	"None of the peptides are hemolytic"	"Resistant with ∼50% intact peptide left after an incubation time of 6.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization(Cys1 and Cys8)"	"Amidation and Cyclization(Cys1 and Cys8)"	"Disulfide bond between Cys1 and Cys8."	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29852"	"CRRWWRFC"	"8"	"Com7"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(LD99=30 µM);##Gram-positive bacteria: Staphylococcus aureus(LD99=1.9 µM), Bacillus subtilis(LD99≦0.45 µM)."	"None of the peptides are hemolytic"	"Resistant with ∼50% intact peptide left after an incubation time of 6.5 h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Acetylation and Cyclization(Cys1 and Cys8)"	"Amidation and Cyclization(Cys1 and Cys8)"	"Disulfide bond between Cys1 and Cys8."	"L"	"No cytotoxicity information found"	"Not found"	"20844765"	"PLoS One. 2010 Sep 10;5(9):e12684."	"Nguyen LT, Chau JK, Perry NA, de Boer L, Zaat SA, Vogel HJ."	"Serum stabilities of short tryptophan- and arginine-rich antimicrobial peptide analogs."
"DRAMP29853"	"AAGIGILTV"	"9"	"MART-127–35"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 22 seconds"	"Human plasma"	"Not mentioned"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29854"	"AAGIGILTV"	"9"	"PEG-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Free"	"Pegylation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29855"	"aAGIGILTv"	"9"	"D-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Free"	"Free"	"D-Ala at 1st position, D-Val at 9th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29856"	"AAGIGILTV"	"9"	"Glyco-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Asn(β-D-GlcNHAc)"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29857"	"AAGIGILTV"	"9"	"Cap-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Acetylation"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29858"	"AAGIGILTV"	"9"	"N-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Acetylation"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29859"	"AAGIGILTV"	"9"	"C-MART-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Stability increased"	"Human plasma"	"Not mentioned"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"10495424"	"Int J Cancer. 1999 Oct 29;83(3):326-34."	"Brinckerhoff LH, Kalashnikov VV, Thompson LW, Yamshchikov GV, Pierce RA, Galavotti HS, Engelhard VH, Slingluff CL Jr."	"Terminal modifications inhibit proteolytic degradation of an immunogenic MART-1(27-35) peptide: implications for peptide vaccines."
"DRAMP29860"	"XXWXIVVIXVXX"	"12"	"Sub3-Agp"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Pseudomonas aeruginosa(MIC=2 µg/ml);##Gram-positive bacteria: Staphylococcus aureus(MIC=1 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life >480 minutes"	"Mouse serum"	"RP-HPLC"	"Linear"	"Free"	"Amidation"	"X= αamino-3-guanidino-propionic acid"	"L"	"No cytotoxicity information found"	"Not found"	"20585128"	"Antimicrob Agents Chemother. 2010 Sep;54(9):4003-5."	"Knappe D, Henklein P, Hoffmann R, Hilpert K."	"Easy strategy to protect antimicrobial peptides from fast degradation in serum."
"DRAMP29861"	"aRRWRIVVIRVRRh"	"14"	"Sub3-D"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Pseudomonas aeruginosa(MIC=2 µg/ml);##Gram-positive bacteria: Staphylococcus aureus(MIC=1 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"With a half-life of approximately 1 h"	"Mouse serum"	"RP-HPLC"	"Linear"	"Free"	"Amidation"	"D-Ala at 1st position, D-His at 14th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"20585128"	"Antimicrob Agents Chemother. 2010 Sep;54(9):4003-5."	"Knappe D, Henklein P, Hoffmann R, Hilpert K."	"Easy strategy to protect antimicrobial peptides from fast degradation in serum."
"DRAMP29862"	"aXXWXIVVIXVXXh"	"14"	"Sub3-DAgp"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Pseudomonas aeruginosa(MIC=2 µg/ml);##Gram-positive bacteria: Staphylococcus aureus(MIC=1 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life >480 minutes"	"Mouse serum"	"RP-HPLC"	"Linear"	"Free"	"Amidation"	"X= αamino-3-guanidino-propionic acid, D-Ala at 1st position, D-His at 14th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"20585128"	"Antimicrob Agents Chemother. 2010 Sep;54(9):4003-5."	"Knappe D, Henklein P, Hoffmann R, Hilpert K."	"Easy strategy to protect antimicrobial peptides from fast degradation in serum."
"DRAMP29863"	"WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF"	"39"	"T-1249"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 5.9h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29864"	"MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELL"	"36"	"T-651"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 0.3h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29865"	"MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL"	"38"	"T-2410"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 1.2h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29866"	"TTWEAWDRAIAEYAARIEALIRASQEQQEKNEAELREL"	"38"	"T-290676"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 1.2h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29867"	"TTWEAWDRAIAEYAARIEALIRAAQEQQEKNEAALREL"	"38"	"T-2635"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 16.3h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29868"	"MTWEAWDRAIAEYAARIEALIRAAQEQQEKNEAALREL"	"38"	"T-2544"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 5.1h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29869"	"TTWEAWDRAIAEYAARIEALIRAAQEQQEKNEAILREL"	"38"	"T-267209"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 3.4h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29870"	"TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAALREL"	"38"	"T-267221"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 15.2h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29871"	"TTWEAWDRAIAEYAARIEALIRAAQELQEKNEAALREL"	"38"	"T-267226"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 7.6h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29872"	"TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL"	"38"	"T-267225"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 12.4h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29873"	"TTWEAWDRAIAEYAARIEALIRAAQEQQEKLEAALREL"	"38"	"T-267227"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 17.9h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29874"	"TTWEAWDRAIAEYAARIEALIRAAQEQQEKLEAVLREL"	"38"	"T-291022"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 28.6h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29875"	"TTWEAWDRAIAEYAARIEALIRALQELQEKNEAALREL"	"38"	"T-290822"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 8.6h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29876"	"TTWEAWDRAIAEYAARIEALIRALQELQEKNEAILREL"	"38"	"T-290821"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 9.6h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29877"	"TTWEAWDRAIAEYAARIEALIRAAQELQEKLEAALREL"	"38"	"T-267228"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 30.8h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29878"	"TTWEAWDRAIAEYAARIEALIRALQELQEKLEAILREL"	"38"	"T-267229"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Half-life is 35.4h."	"Monkey serum"	"RP-HPLC"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"17640899"	"Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7."	"Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK."	"Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus."
"DRAMP29879"	"ICLKKWPWWPWRRCK"	"15"	"cycloCP-11"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(MIC=16 µg/ml), Pseudomonas aeruginosa(MIC=64 µg/ml), Salmonella typhimurium(MIC=4µg/ml);##Gram-positive bacteria: Staphylococcus aureus(MIC=16 µg/ml), Staphylococcus epidermidis(MIC=8 µg/ml), Enterococcus faecalis(MIC=64 µg/ml)."	"Less than 5% hemolysis of human erythrocytes was observed after 1 h of treatment with peptide at concentrations up to 256 µg/mL."	"Half-life is 4 minutes."	"Trypsin"	"HPLC"	"Cyclic"	"Free"	"Amidation"	"Disulfide bond between Cys2 and Cys14."	"L"	"No cytotoxicity information found"	"Not found"	"14640680"	"Biochemistry. 2003 Dec 9;42(48):14130-8."	"Rozek A, Powers JP, Friedrich CL, Hancock RE."	"Structure-based design of an indolicidin peptide analogue with increased protease stability."
"DRAMP29880"	"ILKKWPWWPWRRK"	"13"	"CP-11"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(MIC=8 µg/ml), Pseudomonas aeruginosa(MIC=16 µg/ml), Salmonella typhimurium(MIC=64µg/ml);##Gram-positive bacteria: Staphylococcus aureus(MIC=16 µg/ml), Staphylococcus epidermidis(MIC=4 µg/ml), Enterococcus faecalis(MIC>64 µg/ml)."	"Less than 5% hemolysis of human erythrocytes was observed after 1 h of treatment with peptide at concentrations up to 256 µg/mL."	"Half-life is 18 minutes."	"Trypsin"	"HPLC"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"14640680"	"Biochemistry. 2003 Dec 9;42(48):14130-8."	"Rozek A, Powers JP, Friedrich CL, Hancock RE."	"Structure-based design of an indolicidin peptide analogue with increased protease stability."
"DRAMP29881"	"VDKPPYLPRPRPPRRIYNR"	"19"	"O-1(Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml), Escherichia coli DSM 1103(MIC=8 µg/ml), Klebsiella pneumoniae DSM 681(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=8 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 68 ±15 min in 25% aqueous mouse serum, 25±4 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29882"	"VDKPPYLPRPRPPRRIYN"	"18"	"O-2 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=64 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=128 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 120 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29883"	"VDKPPYLPRPRPPRRIYNN"	"19"	"O-4 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=16µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=64 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 120 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29884"	"VDKPPYLPRPRPPRRIYNH"	"19"	"O-5 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=16 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=16 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 90 ±1 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29885"	"VDKPPYLPRPRPPRRIYN-Orn"	"19"	"O-6 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=16 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 210 ±60 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Orn=Ornithine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29886"	"VDKPPYLPRPRPPRRIYN-Agp"	"19"	"O-7 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=8 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 98 ±6 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Agp = α-amino-3-guanidinopropionic acid"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29887"	"VDKPPYLPRPRPPRRIYN-Nir"	"19"	"O-8 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=16 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 78 ±2 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Nir=Nitro-arginine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29888"	"VDKPPYLPRPRPPRRIYN-Nmr"	"19"	"O-9 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 79 ±3 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Nmr =N-methylarginine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29889"	"VDKPPYLPRPRPPRRIYN-Har"	"19"	"O-10 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=8 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 94 ±1 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Har=Homoarginine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29890"	"VDKPPYLPRPRPPRRIYNr"	"19"	"O-11 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 160 ±5 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"D-Arg at 19th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29891"	"VDKPPYLPRPRPPRRIYNR-NHpr"	"19"	"O-12 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=8 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is >120 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Propylamidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29892"	"VDKPPYLPRPRPPR-Orn-IYNR"	"19"	"O-14 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=16 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 90 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"orn =Ornithine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29893"	"VDKPPYLPRPRPPR-beta-Hr-IYNR"	"19"	"O-15 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=16 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 150 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Beta-Hr =β-homoarginine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29894"	"VDKPPYLPRPRPPRrIYNR"	"19"	"O-16 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 58 ±2 min in 25% aqueous mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"D-Arg at 15th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29895"	"VDKPPYLPRPRPPR-Har-IYN-Har"	"19"	"O-17 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml), Escherichia coli DSM 1103(MIC=8 µg/ml), Klebsiella pneumoniae DSM 681(MIC=2 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 55 ±0 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Har=Homoarginine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29896"	"VDKPPYLPRPRPPR-Har-IYN-Agp"	"19"	"O-18 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 62 ±4 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Har=Homoarginine, Agp = α-amino-3-guanidinopropionic acid"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29897"	"VDKPPYLPRPRPPR-Agp-IYN-Har"	"19"	"O-19 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=2 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 111 ±6 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Har=Homoarginine, Agp = α-amino-3-guanidinopropionic acid"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29898"	"VDKPPYLPRPRPPR-Agp-IYN-Agp"	"19"	"O-20 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml), Escherichia coli DSM 1103(MIC=4 µg/ml), Klebsiella pneumoniae DSM 681(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"[Ref.21185160]There was no indication of any haemolytic activity up to peptide concentrations of 600 µg/ml."	"The half-live is 171 ±20 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Agp = α-amino-3-guanidinopropionic acid"	"L"	"[Ref.21185160]The MTT test against human Hela cell line did not indicate any toxicity at peptide concentrations of 600 µg/ml."	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29899"	"VDKPPYLPRPRPPR-Orn-IYN-Har"	"19"	"O-21 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 75 ±1 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Har=homoarginine, Orn=Ornithine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29900"	"VDKPPYLPRPRPPR-Orn-IYN-Agp"	"19"	"O-22 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 103 ±5 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Agp = α-amino-3-guanidinopropionic acid, Orn=Ornithine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29901"	"VDKPPYLPRPRPPR-Orn-IYN-Orn"	"19"	"O-23(Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=8 µg/ml), Escherichia coli DSM 1103(MIC=4 µg/ml), Klebsiella pneumoniae DSM 681(MIC=2 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=8 µg/ml)."	"[Ref.21185160]There was no indication of any haemolytic activity up to peptide concentrations of 600 µg/ml."	"The half-live is 176 ±8 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"Orn=Ornithine"	"L"	"[Ref.21185160]The MTT test against human Hela cell line did not indicate any toxicity at peptide concentrations of 600 µg/ml."	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29902"	"VDKPPYLPRPRPPRrIYNr"	"19"	"O-24 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml), Escherichia coli DSM 1103(MIC=2 µg/ml), Klebsiella pneumoniae DSM 681(MIC=2 µg/ml)."	"[Ref.21185160]There was no indication of any haemolytic activity up to peptide concentrations of 600 µg/ml."	"The half-live is >480(79.6 ±0.2%) min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Amidation"	"D-Arg at 19th position"	"Mixed"	"[Ref.21185160]The MTT test against human Hela cell line did not indicate any toxicity at peptide concentrations of 600 µg/ml."	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29903"	"VDKPPYLPRPRPPR-Orn-IYNR"	"19"	"O-25 (Oncocin)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli BL21AI(MIC=4 µg/ml), Escherichia coli DSM 1103(MIC=8 µg/ml), Klebsiella pneumoniae DSM 681(MIC=4 µg/ml);##Gram-positive bacteria: Micrococcus luteus ATCC 10240(MIC=4 µg/ml)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is 102 ±2 min in full mouse serum."	"Mouse serum"	"Matrix-assisted laser desorption/ionisation–time-of-flight mass spectrometry (MALDI-TOF-MS)"	"Linear"	"Free"	"Propylamidation"	"Orn=Ornithine"	"L"	"No cytotoxicity information found"	"Not found"	"21185160"	"Int J Antimicrob Agents. 2011 Feb;37(2):166-70."	"Knappe D, Kabankov N, Hoffmann R"	"Bactericidal oncocin derivatives with superior serum stabilities"
"DRAMP29904"	"TTWEAWDRAIAEYAARIEALLRALQEQQEKNEAALREL"	"38"	"TRI-1144"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 1"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half life is 4.2h."	"Rat plasma, human plasma"	"LC-MS/MS"	"Linear"	"Acetylation"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"25900863"	"Eur J Pharm Biopharm. 2015 Jun;93:254-9."	"Schneider EL, Ashley GW, Dillen L, Stoops B, Austin NE, Malcolm BA, Santi DV."	"Half-life extension of the HIV-fusion inhibitor peptide TRI-1144 using a novel linker technology. Eur J Pharm Biopharm"
"DRAMP29905"	"TTWEAWDRAIAEYAARIEALLRALQEQQEKNEAALREL"	"38"	"PEG-TRI-1144"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 2"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half life is 34h in rat plasma and 70h in human plasma."	"Rat plasma, human plasma"	"LC-MS/MS"	"Linear"	"Acetylation"	"Amidation"	"Conjugated with PEG(40KDa) throµgh Lys-30"	"L"	"No cytotoxicity information found"	"Not found"	"25900863"	"Eur J Pharm Biopharm. 2015 Jun;93:254-9."	"Schneider EL, Ashley GW, Dillen L, Stoops B, Austin NE, Malcolm BA, Santi DV."	"Half-life extension of the HIV-fusion inhibitor peptide TRI-1144 using a novel linker technology. Eur J Pharm Biopharm"
"DRAMP29906"	"TTWEAWDRAIAEYAARIEALLRALQEQQEKNEAALREL"	"38"	"PEG40kDa[ClPhSO2]TRI-1144"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 3"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half life is 150h both in rat plasma and human plasma."	"Rat plasma, human plasma"	"LC-MS/MS"	"Linear"	"Acetylation"	"Amidation"	"Conjugated with PEG(40KDa) throµgh Lys-30"	"L"	"No cytotoxicity information found"	"Not found"	"25900863"	"Eur J Pharm Biopharm. 2015 Jun;93:254-9."	"Schneider EL, Ashley GW, Dillen L, Stoops B, Austin NE, Malcolm BA, Santi DV."	"Half-life extension of the HIV-fusion inhibitor peptide TRI-1144 using a novel linker technology. Eur J Pharm Biopharm"
"DRAMP29907"	"TTWEAWDRAIAEYAARIEALLRALQEQQEKNEAALREL"	"38"	"PEG40kDa[MorphSO2]TRI-1144"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Virus: HIV type 4"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half life is 4.4h."	"Rat plasma, human plasma"	"LC-MS/MS"	"Linear"	"Acetylation"	"Amidation"	"Conjugated with PEG(40KDa) throµgh Lys-30"	"L"	"No cytotoxicity information found"	"Not found"	"25900863"	"Eur J Pharm Biopharm. 2015 Jun;93:254-9."	"Schneider EL, Ashley GW, Dillen L, Stoops B, Austin NE, Malcolm BA, Santi DV."	"Half-life extension of the HIV-fusion inhibitor peptide TRI-1144 using a novel linker technology. Eur J Pharm Biopharm"
"DRAMP29908"	"LLTHTISRIAVSYQTKVNLL"	"20"	"P16 [TNF α (75–94)]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-life is 9.72h."	"Rat plasma"	"LC/MS"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"26337231"	"Sci Rep. 2015 Sep 4;5:13595."	"Ma Y, Zhao S, Shen S, Fang S, Ye Z, Shi Z, Hong A"	"A novel recombinant slow-release TNF α-derived peptide effectively inhibits tumor growth and angiogensis."
"DRAMP29909"	"MWQRPSSWIEGRLLTHTISRIAVSYQTKVNLL"	"32"	"RMP-16 (Recombinant slow-release TNF α-derived peptide)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-life is 15.83h."	"Rat plasma"	"LC/MS"	"Linear"	"Free"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"26337231"	"Sci Rep. 2015 Sep 4;5:13595."	"Ma Y, Zhao S, Shen S, Fang S, Ye Z, Shi Z, Hong A"	"A novel recombinant slow-release TNF α-derived peptide effectively inhibits tumor growth and angiogensis."
"DRAMP29910"	"GRCTKSIPPICYPD"	"14"	"cSFTI"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"PC-3 or DU-145 prostate cancer cells. "	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is found to be 75.8h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization (N termini to C termini)"	"Cyclization (C termini to N termini)"	"Disulfide bond between Cys3 and Cys11."	"L"	"No cytotoxicity information found"	"Not found"	"19937135"	"Mol Imaging Biol. 2010 Aug;12(4):377-85"	"Boy RG, Mier W, Nothelfer EM, Altmann A, Eisenhut M, Kolmar H, Tomaszowski M, Krämer S, Haberkorn U."	"Sunflower trypsin inhibitor 1 derivatives as molecular scaffolds for the development of novel peptidic radiopharmaceuticals"
"DRAMP29911"	"GRCTKSIPPICYPD"	"14"	"oSFTI"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"PC-3 or DU-145 prostate cancer cells. "	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is found to be 34.5h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"Cyclization(Cys3 and Cys11)"	"Cyclization(Cys3 and Cys11)"	"Disulfide bond between Cys3 and Cys11."	"L"	"No cytotoxicity information found"	"Not found"	"19937135"	"Mol Imaging Biol. 2010 Aug;12(4):377-85"	"Boy RG, Mier W, Nothelfer EM, Altmann A, Eisenhut M, Kolmar H, Tomaszowski M, Krämer S, Haberkorn U."	"Sunflower trypsin inhibitor 1 derivatives as molecular scaffolds for the development of novel peptidic radiopharmaceuticals"
"DRAMP29912"	"GRCTKSIPPICYPD"	"14"	"DOTA-SFTI"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"PC-3 or DU-145 prostate cancer cells. "	"No hemolysis information or data found in the reference(s) presented in this entry"	"The half-live is found to be 41.7h."	"Human Serum"	"RP-HPLC"	"Cyclic"	"DOTA(metal chelator), and Cyclization(Cys3 and Cys11)"	"Cyclization(Cys3 and Cys11)"	"Disulfide bond between Cys3 and Cys11."	"L"	"No cytotoxicity information found"	"Not found"	"19937135"	"Mol Imaging Biol. 2010 Aug;12(4):377-85"	"Boy RG, Mier W, Nothelfer EM, Altmann A, Eisenhut M, Kolmar H, Tomaszowski M, Krämer S, Haberkorn U."	"Sunflower trypsin inhibitor 1 derivatives as molecular scaffolds for the development of novel peptidic radiopharmaceuticals"
"DRAMP29913"	"RFGRFLRKIRRFRPK "	"15"	"CATH-2(C1-15)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The antibacterial activity of C1-15 decreased substantially after incubation for 1h in serum, with a complete abolishment after 2h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29914"	"rfgrflrkirrfrpk"	"15"	"All-D-CATH-2(C1-15"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"the antibacterial activity of D-C1-15 was maintained up to 24h incubation in serum"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"D-Arg at 1st, 4th, 7th, 10th, 11th, and 13th position, D-Phe at 2nd, 5th, and 12th position, D-Gly at 3rd position, D-Leu at 6th position, D-Lys at 8th, and 15th position, D-Ile at 9th position, D-Pro at 14th position"	"D"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29915"	"RFGRFLRKIRRFRPK"	"15"	"Cyclic-CATH-2(C1-15)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"The antimicrobial activity of cyclic-C1-15 was lost after 3h"	"Human serum"	" Radial diffusion assays"	"Cyclic"	"Cyclization (N termini to C termini)"	"Cyclization (C termini to N termini)"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29916"	"RWGRWLRKIRRWRPK "	"15"	"CATH-2(C1-15)(F2,5,12 W)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"peptide F2,5,12Wshowed a 2.5 times improved stability of antibacterial activity inthe presence of serum"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29917"	"rwgrwlrkirrwrpk"	"15"	"All-D-CATH-2(C1-15)(F2,5,12 W）"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Cyclization of F2,5,12W fur-ther improved the stability in serum; in the presence of serumthe peptide maintained its antibacterial activity up to 6h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"D-Arg at D-Ala at 1st position, D-His at 9th position, D-Trp at D-Ala at 1st position, D-His at 9th position, D-Gly at 3rd position, D-Leu at 6th position, D-Ala at 1st position, D-His at 9th position"	"D"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29918"	"RWGRWLRKIRRWRPK "	"15"	"Cyclic-CATH-2(C1-15)( F2,5,12 W)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Sus-tained antibacterial activity up to 24h was observed for peptideD-F2,5,12W."	"Human serum"	" Radial diffusion assays"	"Cyclic"	"Cyclization (N termini to C termini)"	"Cyclization (C termini to N termini)"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"21376095"	"Peptides. 2011 May;32(5):875-80"	"Molhoek EM, van Dijk A, Veldhuizen EJ, Haagsman HP, Bikker FJ."	"Improved proteolytic stability of chicken cathelicidin-2 derived peptides by D-amino acid substitutions and cyclization."
"DRAMP29919"	"HWSHDWKPG"	"9"	"GnRH-III(4Ser,8Lys (DaudAoa)"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No LC50s found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"All bioconjugates showed high stability in the presence of pepsin even after 24 h of incubation, as no proteolytic fragmentswere identified by LC-MS"	"Trypsin, ?-chymotrypsin, and pepsin"	"LC-MS"	"Linear"	"Free"	"Free"	"K(8)=(Dau=Aoa)"	"L"	"[Ref.21668011]IC50=6.5±1.8 μM against MCF-7 human breast cell lines, IC50=27.8±5.4 μM against HT-29 human colon cell lines, IC50=6.1±2.1 μM against LNCaP human prostate cancer cell lines ."	"Not found"	"21668011"	"Bioconjug Chem. 2011 Jul 20;22(7):1320-9."	"Manea M, Leurs U, Orbán E, Baranyai Z, Öhlschläger P, Marquardt A, Schulcz Á, Tejeda M, Kapuvári B, Tóvári J, Mezo G."	"Enhanced enzymatic stability and antitumor activity of daunorubicin-GnRH-III bioconjugates modified in position 4."
"DRAMP29920"	"HWSHDWKPG"	"9"	"GnRH-III(N-Me-4Ser,8Lys(DaudAoa))"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No LC50s found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"All bioconjugates showed high stability in the presence of pepsin even after 25 h of incubation, as no proteolytic fragmentswere identified by LC-MS"	"Trypsin, ?-chymotrypsin, and pepsin"	"LC-MS"	"Linear"	"Free"	"Free"	"K(8)=(Dau=Aoa);S(4)=-N-Me"	"L"	"[Ref.21668011]IC50=10.65±2.1 μM against MCF-7 human breast cell lines, IC50>50 μM against HT-29 human colon cell lines, IC50=14.1±1.3 μM against LNCaP human prostate cancer cell lines ."	"Not found"	"21668011"	"Bioconjug Chem. 2011 Jul 20;22(7):1320-9."	"Manea M, Leurs U, Orbán E, Baranyai Z, Öhlschläger P, Marquardt A, Schulcz Á, Tejeda M, Kapuvári B, Tóvári J, Mezo G."	"Enhanced enzymatic stability and antitumor activity of daunorubicin-GnRH-III bioconjugates modified in position 4."
"DRAMP29921"	"HWKHDWKPG"	"9"	"GnRH-III(4Lys(Ac),8Lys(DaudAoa))"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No LC50s found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"All bioconjugates showed high stability in the presence of pepsin even after 26 h of incubation, as no proteolytic fragmentswere identified by LC-MS"	"Trypsin, ?-chymotrypsin, and pepsin"	"LC-MS"	"Linear"	"Free"	"Free"	"K(8)=(Dau=Aoa);K(4)=-Ac"	"L"	"[Ref.21668011]IC50=3.1±1.7 μM against MCF-7 human breast cell lines, IC50=7.4±2.6μM against HT-29 human colon cell lines, IC50=3.6±2.9 μM against LNCaP human prostate cancer cell lines ."	"Not found"	"21668011"	"Bioconjug Chem. 2011 Jul 20;22(7):1320-9."	"Manea M, Leurs U, Orbán E, Baranyai Z, Öhlschläger P, Marquardt A, Schulcz Á, Tejeda M, Kapuvári B, Tóvári J, Mezo G."	"Enhanced enzymatic stability and antitumor activity of daunorubicin-GnRH-III bioconjugates modified in position 4."
"DRAMP29922"	"HWKHDWKPG"	"9"	"GnRH-III(4Lys(Ac),8Lys(DaudAoa))"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No LC50s found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"All bioconjugates showed high stability in the presence of pepsin even after 27 h of incubation, as no proteolytic fragmentswere identified by LC-MS"	"Trypsin, ?-chymotrypsin, and pepsin"	"LC-MS"	"Linear"	"Free"	"Free"	"K(8)=(Dau=Aoa)"	"L"	"[Ref.21668011]IC50=2.6±0.8 μM against MCF-7 human breast cell lines, IC50=8.1±2.6 μM against HT-29 human colon cell lines, IC50=5.1±0.4 μM against LNCaP human prostate cancer cell lines ."	"Not found"	"21668011"	"Bioconjug Chem. 2011 Jul 20;22(7):1320-9."	"Manea M, Leurs U, Orbán E, Baranyai Z, Öhlschläger P, Marquardt A, Schulcz Á, Tejeda M, Kapuvári B, Tóvári J, Mezo G."	"Enhanced enzymatic stability and antitumor activity of daunorubicin-GnRH-III bioconjugates modified in position 4."
"DRAMP29923"	"QMRRKVELFTYMRFD"	"15"	"SP40"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antiviral"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"[Ref.34314773]Virus: EV-A71: 93 ± 3% inhibition at peptide concentration of  100 μM"	"No hemolysis information or data found in the reference(s) presented in this entry"	"58% remaining after 24 hours, 56% remaining after 48 hours"	"Human Serum"	"RP-HPLC"	"Linear"	"Acetylation"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"34314773"	"Virus Res. 2021 Oct 2;303:198456"	"Zarif F, Anasir MI, Koh JX, Chew MF, Poh CL."	"Stability and antiviral activity of SP40 peptide in human serum."
"DRAMP29924"	"NAYPNLRGDLQVLAQKVARTK"	"21"	"A20FMDV2"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Anti-cancer"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Not available"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Degraded by over 50% in normal mouse serum within a 4 h incubation at 37 °C"	"Mouse serum"	"MALDI-TOF MS"	"Linear"	"biotin"	"Free"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"33857478"	"J Biol Chem. 2021 Jan-Jun;296:100657."	"Cardle II, Jensen MC, Pun SH, Sellers DL"	"Optimized serum stability and specificity of an αvβ6 integrin-binding peptide for tumor targeting."
"DRAMP29925"	"AkRLkkLAkkIWkWk"	"15"	"HPA3NT3-A2D"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(MIC=4 µM), Escherichia coli CCARM 1229(MIC=1 µM), Escherichia coli CCARM 1238(MIC=2 µM), Pseudomonas aeruginosa 3547(MIC=2 µM), Pseudomonas aeruginosa 4007(MIC=4 µM), Salmonella typhimurium CCARM 8009(MIC=8 µM), Salmonella typhimurium CCARM 8013(MIC=4 µM);##Gram-positive bacteria: Staphylococcus aureus(MIC=2 µM), Staphylococcus aureus CCARM 3089(MIC=4 µM), Staphylococcus aureus CCARM 3114(MIC=2 µM), Staphylococcus aureus PBEL 1(MIC=4 µM), Staphylococcus aureus PBEL 2(MIC=4 µM)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"Remaining 100% more than 120min"	"Not mentioned"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"D-Lys at 2nd, 5th, 6th, 9th, 10th, 13th, and 15th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"32781586"	"Int J Mol Sci. 2020 Aug 6;21(16):5632."	"Lee JK, Park Y"	"All d-Lysine Analogues of the Antimicrobial Peptide HPA3NT3-A2 Increased Serum Stability and without Drug Resistance"
"DRAMP29926"	"glrrllrkirgrwkGGGRGGRLCYCRRRFCVCVGR"	"35"	"synPG-1"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli(MBC=2 µM), Salmonella typhimurium(MIBC=4 µM);##Gram-positive bacteria: Methicillin-resistant Staphylococcus aureus(MBC=0.5 µM), Methicillin-resistant Staphylococcus pseudointermedius(MBC=0.5 µM)."	"No hemolysis information or data found in the reference(s) presented in this entry"	"Incubated in 25% porcine serum for up to 7 or 24 h, maintained strong antimicrobial activity even after 24 h of incubation in serum"	"Porcine serum"	"Colony growth"	"Linear"	"Free"	"Free"	"D-Gly at 1st, and 11th position, D-Leu at 2nd, 5th,and 6th position, D-Arg at 3rd, 4th, 7th, 10th, and 12th position, D-Lys at 8th, and 14th position, D-Ile at 9th position, D-Trp at 13th position"	"Mixed"	"No cytotoxicity information found"	"Not found"	"32650576"	"Biomolecules. 2020 Jul 8;10(7):1014."	"Maystrenko A, Feng Y, Akhtar N, Li J."	"The Addition of a Synthetic LPS-Targeting Domain Improves Serum Stability While Maintaining Antimicrobial, Antibiofilm, and Cell Stimulating Properties of an Antimicrobial Peptide"
"DRAMP29927"	"fikriarllrkif"	"13"	"dKN2-7"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"Remains 78.5% of dKn2-7, at 37°C."	"Human plasma"	"LC-MS"	"Linear"	"Free"	"Amidation"	"D-Phe at 1st, and 13th position, D-Ile at 2nd, 5th, and 12th position, D-Lys at 3rd, and 11th position, D-Arg at 4th, 7th, and 10th position, D-Ala at 6th position, D-Leu at 8th, and 9th position"	"D"	"No cytotoxicity information found"	"Not found"	"35909998"	"Future Sci OA. 2022 Jul 20;8(6):FSO807."	"Chen W, Kirui D, Millenbaugh NJ."	"Optimized peptide extraction method for analysis of antimicrobial peptide Kn2-7/dKn2-7 stability in human serum by LC-MS. Future Sci OA."
"DRAMP29928"	"FLQHIIGALGHLF"	"13"	"Temporin-GHa"	"No entry found"	"Not found"	"Not found"	"Sylvirana guentheri (Hylarana guentheri)"	"Antimicrobial, Antibacterial"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"＞90% remaining after 3h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"28338958"	"Acta Biochim Biophys Sin (Shanghai). 2017 May 1;49(5):450-457."	"Dong Z, Luo W, Zhong H, Wang M, Song Y, Deng S, Zhang Y."	"Molecular cloning and characterization of antimicrobial peptides from skin of Hylarana guentheri."
"DRAMP29929"	"FIHHIIGALGHLF"	"13"	" Temporin-GHb"	"No entry found"	"Not found"	"Not found"	"Sylvirana guentheri (Hylarana guentheri)"	"Antimicrobial, Antibacterial"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"about 101%remaining after 3h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"28338958"	"Acta Biochim Biophys Sin (Shanghai). 2017 May 1;49(5):450-457."	"Dong Z, Luo W, Zhong H, Wang M, Song Y, Deng S, Zhang Y."	"Molecular cloning and characterization of antimicrobial peptides from skin of Hylarana guentheri."
"DRAMP29930"	"FLQHIIGALTHIF"	"13"	" Temporin-GHc"	"No entry found"	"Not found"	"Not found"	"Sylvirana guentheri (Hylarana guentheri)"	"Antimicrobial, Antibacterial"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"＞90% remaining after 3h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"28338958"	"Acta Biochim Biophys Sin (Shanghai). 2017 May 1;49(5):450-457."	"Dong Z, Luo W, Zhong H, Wang M, Song Y, Deng S, Zhang Y."	"Molecular cloning and characterization of antimicrobial peptides from skin of Hylarana guentheri."
"DRAMP29931"	"FLQHIIGALSHFF"	"13"	" Temporin-GHd"	"No entry found"	"Not found"	"Not found"	"Sylvirana guentheri (Hylarana guentheri)"	"Antimicrobial, Antibacterial"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"No MICs found in DRAMP database"	"No hemolysis information or data found in the reference(s) presented in this entry"	"about 95%remaining after 3h"	"Human serum"	" Radial diffusion assays"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"28338958"	"Acta Biochim Biophys Sin (Shanghai). 2017 May 1;49(5):450-457."	"Dong Z, Luo W, Zhong H, Wang M, Song Y, Deng S, Zhang Y."	"Molecular cloning and characterization of antimicrobial peptides from skin of Hylarana guentheri."
"DRAMP29932"	"guONNRPVYIPRPRPPHPRL"	"18"	"Api137"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=2 µg/ml), Klebsiella pneumoniae DSM 681(MIC= µg/ml), Pseudomonas aeruginosa DSM 1117 in 50% MHB(MIC=256 µg/ml), Pseudomonas aeruginosa DSM 3227 in 50% MHB(MIC>256 µg/ml), Pseudomonas aeruginosa DSM 9644 in 50% MHB(MIC=256 µg/ml), Pseudomonas aeruginosa DSM 1117 in 100% MHB(MIC>256 µg/ml), Pseudomonas aeruginosa DSM 3227 in 100% MHB(MIC>256 µg/ml), Pseudomonas aeruginosa DSM 9664in 100% MHB(MIC>256 µg/ml)."	"[Ref.27243004] Hemolytic grades of peptide is below 2%, non-hemolytic to human erythrocytes even at high concentrations of 0.6 g/L."	"Half-life time (mouse serum )=345min"	"Mouse serum"	"RP-HPLC"	"Linear"	"gu = N,N,N′,N′-tetramethylguanidino"	"Free"	"O = L-ornithine"	"L"	"[Ref.27243004]IC50>0.6 g/L on rat cardiomyocytes, IC50>0.6 g/L on Hek293, IC50>0.6 g/L on HeLa."	"Not found"	"27243004"	"Front Cell Dev Biol. 2016 May 10;4:39"	"Bluhm ME, Schneider VA, Schäfer I, Piantavigna S, Goldbach T, Knappe D, Seibel P, Martin LL, Veldhuizen EJ, Hoffmann R."	"N-Terminal Ile-Orn- and Trp-Orn-Motif Repeats Enhance Membrane Interaction and Increase the Antimicrobial Activity of Apidaecins against Pseudomonas aeruginosa"
"DRAMP29933"	"guOWOWORPVYOPRPRPPHPRL	"	"22"	"Api793"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=8 µg/ml), Klebsiella pneumoniae DSM 681(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 1117 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 3227 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 9644 in 50% MHB(MIC=8 µg/ml), Pseudomonas aeruginosa DSM 1117 in 100% MHB(MIC=64 µg/ml), Pseudomonas aeruginosa DSM 3227 in 100% MHB(MIC=256 µg/ml), Pseudomonas aeruginosa DSM 9664in 100% MHB(MIC=64 µg/ml)."	"[Ref.27243004] Hemolytic grades of peptide is below 2%, non-hemolytic to human erythrocytes even at high concentrations of 0.6 g/L."	"Half-life time (mouse serum )=246min"	"Mouse serum"	"RP-HPLC"	"Linear"	"gu = N,N,N′,N′-tetramethylguanidino"	"Free"	"O = L-ornithine, W=Trp-Orn-motifs"	"L"	"[Ref.27243004]IC50>0.6 g/L on rat cardiomyocytes, IC50=0.64±0.05 g/L on Hek293, IC50=0.64±0.15 g/L on HeLa."	"Not found"	"27243004"	"Front Cell Dev Biol. 2016 May 10;4:39"	"Bluhm ME, Schneider VA, Schäfer I, Piantavigna S, Goldbach T, Knappe D, Seibel P, Martin LL, Veldhuizen EJ, Hoffmann R."	"N-Terminal Ile-Orn- and Trp-Orn-Motif Repeats Enhance Membrane Interaction and Increase the Antimicrobial Activity of Apidaecins against Pseudomonas aeruginosa"
"DRAMP29934"	"guOWOWOWORPVYOPRPRPPHPRL	"	"22"	"Api794"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=16 µg/ml), Klebsiella pneumoniae DSM 681(MIC=32 µg/ml), Pseudomonas aeruginosa DSM 1117 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 3227 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 9644 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 1117 in 100% MHB(MIC=32 µg/ml), Pseudomonas aeruginosa DSM 3227 in 100% MHB(MIC=128 µg/ml), Pseudomonas aeruginosa DSM 9664in 100% MHB(MIC=16 µg/ml)."	"[Ref.27243004] Hemolytic grades of peptide is below 2%, non-hemolytic to human erythrocytes even at high concentrations of 0.6 g/L."	"Half-life time (mouse serum )=311min"	"Mouse serum"	"RP-HPLC"	"Linear"	"gu = N,N,N′,N′-tetramethylguanidino"	"Free"	"O = L-ornithine, W=Trp-Orn-motifs"	"L"	"[Ref.27243004]IC50>0.6 g/L on rat cardiomyocytes, IC50=0.28±0.03 g/L on Hek293, IC50=0.23±0.09 g/L on HeLa."	"Not found"	"27243004"	"Front Cell Dev Biol. 2016 May 10;4:39"	"Bluhm ME, Schneider VA, Schäfer I, Piantavigna S, Goldbach T, Knappe D, Seibel P, Martin LL, Veldhuizen EJ, Hoffmann R."	"N-Terminal Ile-Orn- and Trp-Orn-Motif Repeats Enhance Membrane Interaction and Increase the Antimicrobial Activity of Apidaecins against Pseudomonas aeruginosa"
"DRAMP29935"	"guOIOIORPVYOPRPRPPHPRL"	"20"	"Api795 "	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=8 µg/ml), Klebsiella pneumoniae DSM 681(MIC=8 µg/ml), Pseudomonas aeruginosa DSM 1117 in 50% MHB(MIC=8 µg/ml), Pseudomonas aeruginosa DSM 3227 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 9644 in 50% MHB(MIC=8 µg/ml), Pseudomonas aeruginosa DSM 1117 in 100% MHB(MIC=32 µg/ml), Pseudomonas aeruginosa DSM 3227 in 100% MHB(MIC=256 µg/ml), Pseudomonas aeruginosa DSM 9664in 100% MHB(MIC=128 µg/ml)."	"[Ref.27243004] Hemolytic grades of peptide is below 2%, non-hemolytic to human erythrocytes even at high concentrations of 0.6 g/L."	"Half-life time (mouse serum )=354min"	"Mouse serum"	"RP-HPLC"	"Linear"	"gu = N,N,N′,N′-tetramethylguanidino"	"Free"	"O = L-ornithine, I=Ile-Orn-motifs"	"L"	"[Ref.27243004]IC50>0.6 g/L on rat cardiomyocytes, IC50>0.6 g/L on Hek293, IC50>0.6 g/L on HeLa."	"Not found"	"27243004"	"Front Cell Dev Biol. 2016 May 10;4:39"	"Bluhm ME, Schneider VA, Schäfer I, Piantavigna S, Goldbach T, Knappe D, Seibel P, Martin LL, Veldhuizen EJ, Hoffmann R."	"N-Terminal Ile-Orn- and Trp-Orn-Motif Repeats Enhance Membrane Interaction and Increase the Antimicrobial Activity of Apidaecins against Pseudomonas aeruginosa"
"DRAMP29936"	"guOIOIOIORPVYOPRPRPPHPRL	"	"22"	"Api796"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=8µg/ml), Klebsiella pneumoniae DSM 681(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 1117 in 50% MHB(MIC=8 µg/ml), Pseudomonas aeruginosa DSM 3227 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 9644 in 50% MHB(MIC=16 µg/ml), Pseudomonas aeruginosa DSM 1117 in 100% MHB(MIC=64 µg/ml), Pseudomonas aeruginosa DSM 3227 in 100% MHB(MIC=128 µg/ml), Pseudomonas aeruginosa DSM 9664in 100% MHB(MIC=128 µg/ml)."	"[Ref.27243004] Hemolytic grades of peptide is below 2%, non-hemolytic to human erythrocytes even at high concentrations of 0.6 g/L."	"Half-life time (mouse serum )=249min"	"Mouse serum"	"RP-HPLC"	"Linear"	"gu = N,N,N′,N′-tetramethylguanidino"	"Free"	"O = L-ornithine, I=Ile-Orn-motifs"	"L"	"[Ref.27243004]IC50>0.6 g/L on rat cardiomyocytes, IC50>0.6 g/L on Hek293, IC50>0.6 g/L on HeLa."	"Not found"	"27243004"	"Front Cell Dev Biol. 2016 May 10;4:39"	"Bluhm ME, Schneider VA, Schäfer I, Piantavigna S, Goldbach T, Knappe D, Seibel P, Martin LL, Veldhuizen EJ, Hoffmann R."	"N-Terminal Ile-Orn- and Trp-Orn-Motif Repeats Enhance Membrane Interaction and Increase the Antimicrobial Activity of Apidaecins against Pseudomonas aeruginosa"
"DRAMP29937"	"ALFDIIKKIAESF"	"13"	"Aurein-1.2 [G1A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=128 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC=512 µg/ml), Enterococcus faecalis(MIC=128 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=128 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 16% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29938"	"GAFDIIKKIAESF"	"13"	"Aurein-1.2 [L2A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=256 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=512 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=256 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 6% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29939"	"GLADIIKKIAESF"	"13"	"Aurein-1.2 [F3A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=128 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC=512 µg/ml), Enterococcus faecalis(MIC=256 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=128 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 38% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29940"	"GLFAIIKKIAESF"	"13"	"Aurein-1.2 [D4A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=128 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=8 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC=16 µg/ml), Enterococcus faecalis(MIC=32 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=64 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 44% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29941"	"GLFDAIKKIAESF"	"13"	"Aurein-1.2 [I5A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=256 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=128 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=256 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 71% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29942"	"GLFDIAKKIAESF"	"13"	"Aurein-1.2 [I6A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=512µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=256 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=256 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 29% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29943"	"GLFDIIAKIAESF"	"13"	"Aurein-1.2 [K7A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC>512 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=512 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC>512 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 59% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29944"	"GLFDIIKAIAESF"	"13"	"Aurein-1.2 [K8A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=128 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=64 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=64 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 36% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29945"	"GLFDIIKKAAESF"	"13"	"Aurein-1.2 [I9A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=512µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=128 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=512 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 6% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29946"	"GLFDIIKKIAASF"	"13"	"Aurein-1.2 [E11A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=16 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC=64 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC=32 µg/ml), Enterococcus faecalis(MIC=32 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=32µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 17% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29947"	"GLFDIIKKIAEAF"	"13"	"Aurein-1.2 [S12A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=64 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC=32 µg/ml), Enterococcus faecalis(MIC=64 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=32 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 77% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."
"DRAMP29948"	"GLFDIIKKIAESA"	"13"	"Aurein-1.2 [F13A]"	"No entry found"	"Not found"	"Not found"	"Synthetic construct"	"Antimicrobial, Antibacterial, Anti-Gram-"	"Not found"	"Not found"	"Not found"	"None"	"Comment: No comments found on DRAMP database"	"Gram-negative bacterium: Escherichia coli ATCC 25922(MIC=128 µg/ml), Pseudomonas aeruginosa ATCC 9027(MIC>512 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923(MIC>512 µg/ml), Enterococcus faecalis(MIC=128 µg/ml);##Fungi: Candida albicans ATCC 10231(MIC=512 µg/ml)."	"All the analogs were less hemolytically active against human RBCs"	"37℃，in fetal bovine serum, 54% remaining after 6h"	"Fetal bovine serum"	"LC-MS"	"Linear"	"Free"	"Amidation"	"Free"	"L"	"No cytotoxicity information found"	"Not found"	"30569430"	"Probiotics Antimicrob Proteins. 2019 Sep;11(3):1042-1054."	"Migoń D, Jaśkiewicz M, Neubauer D, Bauer M, Sikorska E, Kamysz E, Kamysz W."	"Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2."