DRAMP_ID Sequence Sequence_Length Name Swiss_Prot_Entry Family Gene Source Activity Protein_existence Structure Structure_Description PDB_ID Comments Target_Organism Hemolytic_activity Linear/Cyclic/Branched N-terminal_Modification C-terminal_Modification Other_Modifications Stereochemistry Cytotoxicity Binding_Traget Pubmed_ID Reference Author Title DRAMP03591 ACYCRIPACIAGERRYGTCIYQGRLWAFCC 30 "Neutrophil defensin 1 (Defensin, alpha 1; HNP-1, HP-1; Human, mammals, animals)" "P59665, P11479, Q14125, Q6EZF6" Belongs to the alpha-defensin family "DEFA1, DEFA1B" Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand "Compared to HNP-2, HNP-1 contains one additional residue (Ala) at the N-terminus. It contains a long stretch of a double-stranded antiparallel beta-sheet in a hairpin conformation that contains a beta-bulge, a short region of triple-stranded beta-sheet, and several tight turns." 2KHT resolved by NMR "Function: Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. PTM: ADP-ribosylation drastically reduces cytotoxic and antibacterial activities, and enhances IL8 production. Phosphorylation at Tyr-85 has been found in some cancer cell lines, and interferes with ADP-rybosylation." "[Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 g/mL (290 nM));SARS-CoV-2 variant P.1:inhibition of infection in HeLa-hACE2 cells(67% inbibition at 50 g/mL);SARS-CoV-2 variant B.1.1.7:inhibition of infection in HeLa-hACE2 cells(58% inbibition at 50 g/mL).##[Ref.15616305] Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=3.60.3 g/ml), E. coli ATCC 25922 (vLD50=3.70.4 g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=100.5 g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=4.21.0 g/ml), Staphylococcus aureus ATCC 29213 (vLD50=2.10.3 g/ml), Bacillus cereus ATCC 10876 (vLD50=0.220.03 g/ml).##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s).##[Ref.15118082]Gram-positive bacteria: Bacillus subtilis (Inhibition zone=24 mm in PH5.5, Inhibition zone=20 mm in PH7.5 completely inhibit at 10 g/well), Staphylococcus aureus (Inhibition zone=1 mm in PH5.5, Inhibition zone=7 mm incompletely inhibit and Inhibition zone=2 mm completely inhibit in PH7.5 at 10 g/well);##Gram-negative bacteria: Escherichia coli (Inhibition zone=5 mm incompletely inhibit and Inhibition zone=2 mm completely inhibit in PH7.5 at 10 g/well);##Fungi: Candida albicans (Inhibition zone=13 mm in PH5.5, Inhibition zone=10 mm in PH7.5 completely inhibit at 10 g/well)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Cyclization(Cys2 and Cys30). "Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29." L [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 g/mL. Not found 34206990##19253295##15616305##15118082 Viruses. 2021 Jun 26;13(7):1246.##Proteomics. 2009 Mar;9(5):1364-1373.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.##Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Stegemann C, Kolobov A Jr, Leonova YF, Knappe D, Shamova O, Ovchinnikova TV, Kokryakov VN, Hoffmann R.##Ericksen B, Wu Z, Lu W, Lehrer RI.##Yount NY, Yeaman MR." "Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Isolation, purification and de novo sequencing of TBD-1, the first beta-defensin from leukocytes of reptiles.##Antibacterial activity and specificity of the six human {alpha}-defensins.##Multidimensional signatures in antimicrobial peptides." DRAMP03592 CYCRIPACIAGERRYGTCIYQGRLWAFCC 29 "Neutrophil defensin 2 (HNP-2, HP-2, HP2; Human, mammals, animals)" "P59665, P11479, Q14125, Q6EZF6, P59666, P11479, Q14125" Belongs to the alpha-defensin family DEFA1 AND DEFA1B Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand Not found "1ZMH, 1ZMI, 1ZMK resolved by X-ray." "Function: Defensin 2 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. PTM: Contains three disulfide bonds 1-29; 3-18; 8-28." "[Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 g/mL (290 nM)).##Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=3.50.79 ?g/ml), E. coli ATCC 25922 (vLD50=3.50.6 ?g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=164.0 ?g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=4.20.9 ?g/ml), S. aureus ATCC 29213 (vLD50=2.40.3 ?g/ml), Bacillus cereus ATCC 10876 (vLD50=0.220.04 ?g/ml).(Ref.2)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic No specific N-terminal No specific C-terminal "Disulfide bonds between Cys1 and Cys29,Cys3 and Cys18,Cys8 and Cys28." L No cytotoxicity information found in the reference(s) presented Not found 34206990##15616305##15894545 Viruses. 2021 Jun 26;13(7):1246.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.##J Biol Chem. 2005 Sep 23;280(38):32921-9. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Ericksen B, Wu Z, Lu W, Lehrer RI.##Xie C, Prahl A, Ericksen B, Wu Z, Zeng P, Li X, Lu WY, Lubkowski J, Lu W." Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Antibacterial activity and specificity of the six human {alpha}-defensins.##Reconstruction of the conserved beta-bulge in mammalian defensins using D-amino acids. DRAMP03593 DCYCRIPACIAGERRYGTCIYQGRLWAFCC 30 "Neutrophil defensin 3 (Defensin, alpha 3; HNP-3, HP-3, HP3; Human, mammals, animals)" "P59666, P11479, Q14125" Belongs to the alpha-defensin family DEFA3 Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand "Compared to HNP-2, HNP-3 contains one additional residue (Asp) at the N-terminus. The 3D structures remain the same. " "1DFN, 2PM4, 2PM5 resolved by X-ray." "Function: Defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. PTM: Contains three disulfide bonds 2-30; 4-19; 9-29." "[Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 g/mL (290 nM)).##Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=6.20.9 ?g/ml), E. coli ATCC 25922 (vLD50=5.92.1 ?g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=419.2 ?g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=132.1 ?g/ml), S. aureus ATCC 29213 (vLD50=2.20.4 ?g/ml), Bacillus cereus ATCC 10876 (vLD50=0.370.08 ?g/ml).(Ref.2)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Cyclization(Cys2 and Cys30). "Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29." L No cytotoxicity information found in the reference(s) presented Not found 34206990##4056036##15616305 Viruses. 2021 Jun 26;13(7):1246.##J Clin Invest. 1985 Oct;76(4):1436-1439.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI.##Ericksen B, Wu Z, Lu W, Lehrer RI." Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Primary structures of three human neutrophil defensins.##Antibacterial activity and specificity of the six human {alpha}-defensins. DRAMP03594 VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV 33 "Neutrophil defensin 4 (Defensin, alpha 4; HNP-4, HP-4; Human, mammals, animals)" P12838 Belongs to the alpha-defensin family DEFA4 Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand "Compared to HNP-2, HNP-1 contains one additional residue (Ala) at the N-terminus. It contains a long stretch of a double-stranded antiparallel beta-sheet in a hairpin conformation that contains a beta-bulge, a short region of triple-stranded beta-sheet, and several tight turns." 1ZMM resolved by X-ray. "Function: Has antimicrobial activity against Gram-negative bacteria, and to a lesser extent also against Gram-positive bacteria and fungi. Protects blood cells against infection with HIV-1 (in vitro). In comparison with HNP1-3, inhibition of both strains of HIV-1 by HNP4 was noticeably stronger as evidenced by lower IC50 values (2-5 ?M) and steeper and more complete inhibition curves. PTM: Contains three disulfide bonds 2-30; 4-19; 9-29." "[Ref.34206990]Virus:showed inhibition against SARS-CoV-2.Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=3.30.4 ?g/ml), E. coli ATCC 25922 (vLD50=3.00.7 ?g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=6.60.2 ?g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=7.31.4 ?g/ml), S. aureus ATCC 29213 (vLD50=7.20.2 ?g/ml), Bacillus cereus ATCC 10876 (vLD50=0.870.08 ?g/ml).(Ref.4)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s).##Yeast: Candida albicans ATCC 99788 amphotericin B resistant (IC90>100 ?g/ml).(Ref.2)" No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Free "Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29." L No cytotoxicity information found in the reference(s) presented Not found 34206990##17088326##15620707##15616305 Viruses. 2021 Jun 26;13(7):1246.##Protein Sci. 2006 Dec;15(12):2749-2760.##FEBS Lett. 2005 Jan 3;579(1):162-166.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Szyk A, Wu Z, Tucker K, Yang D, Lu W, Lubkowski J.##Wu Z, Cocchi F, Gentles D, Ericksen B, Lubkowski J, Devico A, Lehrer RI, Lu W.##Ericksen B, Wu Z, Lu W, Lehrer RI." "Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Crystal structures of human alpha-defensins HNP4, HD5, and HD6.##Human neutrophil alpha-defensin 4 inhibits HIV-1 infection in vitro.##Antibacterial activity and specificity of the six human {alpha}-defensins." DRAMP03595 ATCYCRTGRCATRESLSGVCEISGRLYRLCCR 32 "Human defensin-5 (HD-5; Defensin, alpha 5; Human, mammals, animals)" "Q01523, A0JDY6, Q3KNV2" Belongs to the alpha-defensin family DEFA5 Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand The L- and D-forms of HD-5 are equally active than E.coli but not S. aureus (Wei G et al 2009 JBC 284: 29180-92). 1ZMP resolved by X-ray. "Function: Antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing. Tissue specificity: Paneth cells of the small intestine (at protein level). PTM: Contains three disulfide bonds." "[Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(60% inhibition at 12.5 g/mL (3.45 M));SARS-CoV-2 variant P.1:inhibition of infection in HeLa-hACE2 cells(72% inbibition at 50 g/mL);SARS-CoV-2 variant B.1.1.7:inhibition of infection in HeLa-hACE2 cells(32% inbibition at 50 g/mL).##Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=2.50.3 ?g/ml), E. coli ATCC 25922 (vLD50=2.10.9 ?g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=5.50.5 ?g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=6.30.5 ?g/ml), S. aureus ATCC 29213 (vLD50=3.20.3 ?g/ml), Bacillus cereus ATCC 10876 (vLD50<0.31 ?g/ml).(Ref.2)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s)." [Ref.26206286] It has 0% hemolysis at 100M against human red blood cells. Cyclic Free Free "Disulfide bonds between Cys3 and Cys31,Cys5 and Cys20,Cys10 and Cys30." L [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 g/mL. Not found 34206990##12021776##15616305##26206286 Viruses. 2021 Jun 26;13(7):1246.##Nat Immunol. 2002 Jun;3(6):583-590.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.##Peptides. 2015 Sep;71:128-40. doi: 10.1016/j.peptides.2015.07.009. Epub 2015 Jul 20. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Ghosh D, Porter E, Shen B, Lee SK, Wilk D, Drazba J, Yadav SP, Crabb JW, Ganz T, Bevins CL.##Ericksen B, Wu Z, Lu W, Lehrer RI.##Basil Mathew Ramakrishnan Nagaraj" Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Paneth cell trypsin is the processing enzyme for human defensin-5.##Antibacterial activity and specificity of the six human {alpha}-defensins.##Antimicrobial activity of human -defensin 5 and its linear analogs: N-terminal fatty acylation results in enhanced antimicrobial activity of the linear analogs DRAMP03596 AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL 32 "Human defensin-6 (HD-6; Defensin, alpha 6; Human, mammals, animals)" Q01524 Belongs to the alpha-defensin family DEFA6 Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)" Protein level Beta strand (3 strands; 19 residues) Not found "1ZMQ, 3QTE resolved by X-ray." "Function: Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1. Subunit structure: Homodimer. Tissue specificity: Paneth cells of the small intestine. PTM: Contains three disulfide bonds." "[Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(HD6 only blocked SARS-CoV-2 infection at the highest concentration tested (50 g/mL, 13 M)).##Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50>256 ?g/ml), E. coli ATCC 25922 (vLD50=10314 ?g/ml), Enterobacter aerogenes ATCC 13048 (vLD50=15611 ?g/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50>256 ?g/ml), S. aureus ATCC 29213 (vLD50>256 ?g/ml), Bacillus cereus ATCC 10876 (vLD50=2513 ?g/ml).(Ref.3)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Free "Disulfide bonds between Cys4 and Cys31,Cys6 and Cys20,Cys10 and Cys30." L [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 g/mL. Not found 34206990##8417977##17088326##15616305 Viruses. 2021 Jun 26;13(7):1246.##FEBS Lett. 1993; 315:187-192.##Protein Sci. 2006 Dec;15(12):2749-2760.##Antimicrob Agents Chemother. 2005 Jan;49(1):269-275. "Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.##Jones DE, Bevins CL.##Szyk A, Wu Z, Tucker K, Yang D, Lu W, Lubkowski J.##Ericksen B, Wu Z, Lu W, Lehrer RI." "Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.##Defensin-6 mRNA in human Paneth cells: implications for antimicrobial peptides in host defense of the human bowel.##Crystal structures of human alpha-defensins HNP4, HD5, and HD6.##Antibacterial activity and specificity of the six human {alpha}-defensins." DRAMP29151 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL 36 EK1 Q8BB25 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Hemology Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.35087243]Virus:##SARS-CoV-2 Omicron:inhibition of cell-cell fusion in Calu-3 cells(IC50=119.68 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=74.99 nM);inhibition of infection(Pseudovirus)(IC50=309.4 nM);inhibition of infection(Authentic)(IC50=1138 nM);##SARS-CoV-2 Delta:inhibition of cell-cell fusion(IC50=131.8?nM);inhibition of infection(Pseudovirus)(IC50=427.55?nM);##SARS-CoV-2 D614G:inhibition of cell-cell fusion(IC50=314.6?nM);inhibition of infection(Pseudovirus)(IC50=414.85?nM).##[Ref.32231345]Virus:##SARS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=409.3 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=3237 nM);##MERS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=239.5 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=631.8 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=802.1 nM);##HCoV-OC43:ihibition of cell-cell fusion in Huh-7 cells(IC50=787.6 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=1398 nM),inhibit the replication of HCoV-OC43 in RD cells(IC50=1554 nM);##HCoV-229E:ihibition of cell-cell fusion in Huh-7 cells(IC50=207.4 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=3963 nM),inhibit the replication of HCoV-229E in Huh-7 cells(IC50=4375 nM);##HCoV-NL63:ihibition of cell-cell fusion in Huh-7 cells(IC50=751.0 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=7666 nM),inhibit the replication of HCoV-NL63 in LLC-MK2 cells(IC50=3693 nM);##CoV-WIV1:ihibition of cell-cell fusion in Huh-7 cells(IC50=265.7 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=5425 nM);##CoV-Rs3367:ihibition of cell-cell fusion in Huh-7 cells(IC50=237.0 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=6014 nM);##CoV-SHC014:ihibition of cell-cell fusion in Huh-7 cells(IC50=279.6 nM);##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=286.7-315.0 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=2375.0 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=2468 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 35087243##32231345##30989115##32047258 Cell Res. 2022 Apr;32(4):404-406.##Cell Res. 2020 Apr;30(4):343-355.##Sci Adv. 2019 Apr 10;5(4):eaav4580.##Cell Mol Immunol. 2020 Jul;17(7):765-767. "Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.##Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.##Xia S, Yan L, Xu W, Agrawal AS, Algaissi A, Tseng CK, Wang Q, Du L, Tan W, Wilson IA, Jiang S, Yang B, Lu L.##Xia S, Zhu Y, Liu M, Lan Q, Xu W, Wu Y, Ying T, Liu S, Shi Z, Jiang S, Lu L." Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.##Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.##A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.##Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein. DRAMP29152 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL 36 EK1P Q8BB25 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Hemology Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. [Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=69.2 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-C(Palm) None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29153 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL 36 EK1C Q8BB25 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Hemology Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=37.3-48.1 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=139.4 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-C(Chol) None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29154 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL 36 EK1C1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=56.8 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=480.3 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29155 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSG 39 EK1C2 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=48.2 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=418.6 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29156 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSG 39 EK1C3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=10.6 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=86.4 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29157 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1C4 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.35087243]Virus:##SARS-CoV-2 Omicron:inhibition of cell-cell fusion in Calu-3 cells(IC50=3.32 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=0.88 nM);inhibition of infection(Pseudovirus)(IC50=8.63 nM);inhibition of infection(Authentic)(IC50=85.38 nM);##SARS-CoV-2 Delta:inhibition of cell-cell fusion(IC50=4.04?nM);inhibition of infection(Pseudovirus)(IC50=9.83?nM);##SARS-CoV-2 D614G:inhibition of cell-cell fusion(IC50=2.57?nM);inhibition of infection(Pseudovirus)(IC50=5.58?nM).##[Ref.32231345]Virus:##SARS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=4.3 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=11.7 nM);##MERS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=2.5 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=11.1 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=4.2 nM);##HCoV-OC43:ihibition of cell-cell fusion in Huh-7 cells(IC50=7.7 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=37.7 nM),inhibit the replication of HCoV-OC43 in RD cells(IC50=24.8 nM);##HCoV-229E:ihibition of cell-cell fusion in Huh-7 cells(IC50=5.2 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=12.4 nM),inhibit the replication of HCoV-229E in Huh-7 cells(IC50=101.5 nM);##HCoV-NL63:ihibition of cell-cell fusion in Huh-7 cells(IC50=21.4 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=76.6 nM),inhibit the replication of HCoV-NL63 in LLC-MK2 cells(IC50=187.6 nM);##CoV-WIV1:ihibition of cell-cell fusion in Huh-7 cells(IC50=4.5 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=30.8 nM);##CoV-Rs3367:ihibition of cell-cell fusion in Huh-7 cells(IC50=8.1 nM),inhibition of Pseudovirus (PsV) infection in Huh-7 cells(IC50=66.9 nM);##CoV-SHC014:ihibition of cell-cell fusion in Huh-7 cells(IC50=4.3 nM);##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=1.3 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=15.8 nM),inhibit the replication of MERS-CoV in VERO-E6 cells(IC50=2468 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-Chol None L "[Ref.32231345]<10% cytotoxicity against VERO-E6 cells, RD cells, LLC-MK2 cells, Huh-7 cells up to 10000 nM." liposomes 35087243##32231345 Cell Res. 2022 Apr;32(4):404-406.##Cell Res. 2020 Apr;30(4):343-355. "Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.##Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.##Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29158 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1C5 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=3.1 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=31.3 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29159 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1C6 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=3.9 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=77.4 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG12-Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29160 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1C7 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=3.9 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=84.4 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG24-Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29161 LKVLLYEEFKLLESLIMEILEYQKDSDIKENAEDTK 36 EK1-scrambled No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32231345]Virus:SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-OC43,HCoV-229E,HCoV-NL63,CoV-WIV1,CoV-Rs3367,CoV-SHC014(No inhibition on the concentration up to 10 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 32231345 Cell Res. 2020 Apr;30(4):343-355. "Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L." Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. DRAMP29162 NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYGSGC 40 EKL1C No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "EKL1C is a Peptide-based pan-CoV fusion inhibitor,targets a highly conserved target site in HR1 domains in S protein of HCoVs." "[Ref.35087243]Virus:##SARS-CoV-2 Omicron:inhibition of cell-cell fusion in Calu-3 cells(IC50=12.18 nM);inhibition of cell-cell infusion in Caco2 cells(IC50=5.52 nM);inhibition of infection(Pseudovirus)(IC50=26.14 nM);inhibition of infection(Authentic)(IC50=182.2 nM);##SARS-CoV-2 Delta:inhibition of cell-cell fusion(IC50=14.42?nM);inhibition of infection(Pseudovirus)(IC50=31.99?nM);##SARS-CoV-2 D614G:inhibition of cell-cell fusion(IC50=11.77?nM);inhibition of infection(Pseudovirus)(IC50=23.6?nM).##[Ref.34367893]Virus:##SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.0450.006 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.0370.009 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.0400.005 mol/L),inhibition of cell-cell fusion(IC50=0.0080.001 mol/L);inhibited authentic SARS-CoV-2 infection in Vero E6 cells(IC50=0.0030.001 mol/L);##SARS-CoV-2 variants(inhibition of Pseudovirus(PsV) infection):V341L(IC50=0.0470.013 mol/L);F342L(IC50=0.0260.007 mol/L);V367F(IC50=0.0660.012 mol/L);R408I(IC50=0.1480.012 mol/L);N435D(IC50=0.1350.013 mol/L);G476S(IC50=0.0650.008 mol/L);V483A(IC50=0.0780.011 mol/L);N501Y(IC50=0.0690.006 mol/L);D614G(IC50=0.1040.010 mol/L);12 mutations(P.1)(IC50=0.0460.006 mol/L);K417N-E484K-N501Y(IC50=0.1130.013 mol/L);8 mutations(B.1.1.7)(IC50=0.1200.009 mol/L);wide type(IC50=0.0490.007 mol/L);##inhibition of multiple HCoV Pseudovirus:SARS-CoV (IC50=0.0760.014 mol/L), MERS-CoV(IC50=0.0480.006 mol/L), HCoV-OC43(IC50=0.6680.081 mol/L), HCoV-NL63(IC50=0.0350.003 mol/L), SARSr-CoV-WIV1(IC50=0.2180.013 mol/L), and HCoV-Rs3367 (IC50=0.0460.003 mol/L),inhibition of authentic HCoV-OC43 infection in RD cells (IC50=0.2810.018 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L [Ref.34367893]Huh-7 cells:CC50=10 mol/L;Caco-2 cells:CC50=13.81 mol/L;293T/ACE2 cells:CC50=8.49 mol/L. liposomes 35087243##34367893 Cell Res. 2022 Apr;32(4):404-406.##Acta Pharm Sin B. 2021 Aug 2. "Xia S, Chan JF, Wang L, Jiao F, Chik KK, Chu H, Lan Q, Xu W, Wang Q, Wang C, Yuen KY, Lu L, Jiang S.##Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." Peptide-based pan-CoV fusion inhibitors maintain high potency against SARS-CoV-2 Omicron variant.##A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29163 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1-C16 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None EK1-C16 at 0.31 M could effectively inhibit authentic SARS-CoV-2 WT infection. [Ref.35336956]Virus:##SARS-CoV-2 WT:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.48 M);##SARS-CoV-2 Alpha:inhibition of pseudovirus (PsV) infection(IC50=0.19 M);##SARS-CoV-2 Beta:inhibition of pseudovirus (PsV) infection(IC50=0.43 M);##SARS-CoV-2 Gamma:inhibition of pseudovirus (PsV) infection(IC50=0.26 M);##SARS-CoV-2 Delta:inhibition of pseudovirus (PsV) infection(IC50=0.11 M);##SARS-CoV-2 Omicron:inhibition of pseudovirus (PsV) infection(IC50=0.23 M);inhibition of authentic infection in Vero-E6-TMPRSS-2 cells(IC50=0.75 M);##SARS-CoV:inhibition of pseudovirus (PsV) infection(IC50=0.17 M);##SARSr-CoV WIV1:inhibition of pseudovirus (PsV) infection(IC50=0.15 M);##SARSr-CoV Rs3367:inhibition of pseudovirus (PsV) infection(IC50=0.3 M);##MERS-CoV:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.10 M);inhibition of cell-cell fusion(IC50=0.012 M);##HCoV-OC43:inhibition of authentic infection in RD cells(IC50=0.07 M);inhibition of cell-cell fusion(IC50=0.01 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-C16(palmitic acid) None L [Ref.35336956]showed no significant cytotoxicity against RD cells at the concentration of 5 M. Not found 35336956 Viruses. 2022 Mar 6;14(3):549. "Lan Q, Chan JF, Xu W, Wang L, Jiao F, Zhang G, Pu J, Zhou J, Xia S, Lu L, Yuen KY, Jiang S, Wang Q. " "A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern." DRAMP29164 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKW 45 EKL0 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.5830.073 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.4420.037 mol/L),inhibition of cell-cell fusion(IC50=0.2770.029 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29165 NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEY 36 EKL1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:##SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.6220.089 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.7460.152 mol/L),inhibition of cell-cell fusion(IC50=0.2200.034 mol/L);inhibited authentic SARS-CoV-2 infection in Vero E6 cells(IC50=1.4070.189 mol/L);##inhibition of multiple HCoV Pseudovirus:SARS-CoV (IC50=6.7165.937 mol/L), MERS-CoV(IC50=4.0860.345 mol/L), HCoV-OC43(IC50=10.5303.778 mol/L), HCoV-NL63(IC50=3.7000.222 mol/L), SARSr-CoV-WIV1(IC50=30.2704.713 mol/L), and HCoV-Rs3367 (IC50=88.30024.600 mol/L),inhibition of authentic HCoV-OC43 infection in RD cells (IC50=20.2901.092 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29166 TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYV 36 EKL2 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.5260.049 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=4.7141.173 mol/L),inhibition of cell-cell fusion(IC50=1.2400.246 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29167 LDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKW 36 EKL3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50>10 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50>5 mol/L),inhibition of cell-cell fusion(IC50=2.1670.270 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29168 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGC 49 EKL0C No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.1220.012 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.1470.055 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.1620.022 mol/L),inhibition of cell-cell fusion(IC50=0.0210.003 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29169 TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVGSGC 40 EKL2C No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.1150.019 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.0540.014 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.2000.020 mol/L),inhibition of cell-cell fusion(IC50=0.0220.001 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29170 LDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGC 40 EKL3C No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.1270.293 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=1.1761.230 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.8920.069 mol/L),inhibition of cell-cell fusion(IC50=0.0450.004 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29171 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGK 49 EKL0P No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.0930.012 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.6190.341 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.1760.019 mol/L),inhibition of cell-cell fusion(IC50=0.0830.009 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Palm None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29172 NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYGSGK 40 EKL1P No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.1820.034 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.8120.182 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.2310.022 mol/L),inhibition of cell-cell fusion(IC50=0.0640.004 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Palm None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29173 TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVGSGK 40 EKL2P No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=1.1290.166 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.9730.254 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.3040.051 mol/L),inhibition of cell-cell fusion(IC50=0.1830.028 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Palm None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29174 LDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGK 40 EKL3P No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The peptide targets a highly conserved target site in HR1 domains in S protein of HCoVs. "[Ref.34367893]Virus:SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=3.9870.682 mol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 mol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=2.2140.371 mol/L),inhibition of cell-cell fusion(IC50=0.1930.021 mol/L)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Palm None L No cytotoxicity information found in the reference(s) presented liposomes 34367893 Acta Pharm Sin B. 2021 Aug 2. "Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q." A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases. DRAMP29175 DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 36 "2019-nCoV-HR2P(SARS-CoV-2-S(1168-1203),SARS-HR2P)" Q5DIC5 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Hemology Alpha helix Not found None Mechanism of action:2019-nCoV HR1 and HR2 regions are able to interact with each other to form 6-HB and suggest that 2019-nCoV-HR2P may inhibit 2019-nCoV fusion with and entry into the target cell. "[Ref.32047258]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in Huh-7 cells(IC50=0.18 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=0.98 ?M).##[Ref.30989115]SARS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50=0.520.11 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=2.81 ?M);##MERS-CoV:ihibition of cell-cell fusion in Huh-7 cells(IC50>5 ?M);##HCoV-OC43:ihibition of cell-cell fusion in Huh-7 cells(IC50>5 ?M);##HCoV-229E:ihibition of cell-cell fusion in Huh-7 cells(IC50>5 ?M);##HCoV-NL63:ihibition of cell-cell fusion in Huh-7 cells(IC50>5 ?M);##CoV-WIV1:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=2.73 ?M);##CoV-Rs3367:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=3.05 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 30989115##32047258 Sci Adv. 2019 Apr 10;5(4):eaav4580.##Cell Mol Immunol. 2020 Jul;17(7):765-767. "Xia S, Yan L, Xu W, Agrawal AS, Algaissi A, Tseng CK, Wang Q, Du L, Tan W, Wilson IA, Jiang S, Yang B, Lu L.##Xia S, Zhu Y, Liu M, Lan Q, Xu W, Wu Y, Ying T, Liu S, Shi Z, Jiang S, Lu L." A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.##Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein. DRAMP29176 NGAICWGPCPTAFRQIGNCGHFKVRCCKIR 30 MBD-4 (11-40)(P9) P82019 Belongs to the beta-defensin family. Defb4 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found 6M56 Mechanism of action:Mechanistic studies show that positively charged P9 broadly inhibits viral replication by binding to different viruses and then inhibits virusChost endosomal acidification to prevent the endosomal release of pH-dependent viruses. [Ref.32843628]Virus:##SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=2.4 ?g/ml);##SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=6.2 ?g/ml);##MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=8.8 ?g/ml);##Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=34 ?g/ml);##Human parain?uenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 ?g/ml);##Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=1.6 ?g/ml);##Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=3.3 ?g/ml).##[Ref.26911565]Virus:Human Influenza A Virus H1N1(IC50=1.2 ?g/ml);Human Influenza A Virus H3N2(IC50=1.2 ?g/ml);Human Influenza A Virus H5N1(IC50=2.4 ?g/ml);Human Influenza A Virus H7N7(IC50=0.8 ?g/ml);Human Influenza A Virus H7N9(IC50=4.6 ?g/ml);MERS-CoV(IC50=4.8 ?g/ml);SARS-CoV(IC50=4.8 ?g/ml) No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L [Ref.26911565]Xytotoxicity against Madin-Darby canine kidney cells(TC50=380 g/ml). Not found 26911565##32843628 Sci Rep. 2016 Feb 25;6:22008. ##Nat Commun. 2020 Aug 25;11(1):4252. "Zhao H, Zhou J, Zhang K, Chu H, Liu D, Poon VK, Chan CC, Leung HC, Fai N, Lin YP, Zhang AJ, Jin DY, Yuen KY, Zheng BJ.##Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY." A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses. ##A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. DRAMP29177 NGAICWGPCPTAFRQIGNCGRFRVRCCRIR 30 "MBD-4 (11-40) (P9 [H21R,K23R,K28R], P9R)" P82019 Belongs to the beta-defensin family. Defb5 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found 6M56 Mechanism of action:Mechanistic studies show that positively charged P9R broadly inhibits viral replication by binding to different viruses and then inhibits virusChost endosomal acidification to prevent the endosomal release of pH-dependent viruses. [Ref.32843628]Virus:##SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=0.9 ?g/ml);##SARS-CoV:Inhibition of infection in Vero E6 cells(IC50=4.2 ?g/ml);##MERS-CoV:Inhibition of infection in Vero E6 cells(IC50=22 ?g/ml);##Human rhinovirus (HRV):inhibition of infection in RD cells(IC50=5.7 ?g/ml);##Human parain?uenza virus 3:Inhibition of infection in LLC-MK2 cells(IC50>25 ?g/ml);##Human Influenza A Virus H1N1:Inhibition of infection In MDCK cells(IC50=0.6 ?g/ml);##Human Influenza A Virus H7N9:Inhibition of infection In MDCK cells(IC50=0.9 ?g/ml). [Ref.32843628]P9R did not cause the hemolysis of Chicken red blood cells. Linear Free Free None L "[Ref.32843628]the CC50 of P9R was >300?g/ml for MDCK, VeroE6 and A549 cells." Not found 32843628 Nat Commun. 2020 Aug 25;11(1):4252. "Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KY." A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. DRAMP29178 NGAICWGPCPTAFRQIGNCGRFRVRCCRIR 30 8P9R(branched P9R) No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:Have dual-antiviral mechanisms of cross-linking viruses to stop viral entry (mediated by TMPRSS2 for SARS-CoV-2) and of reducing endosomal acidification to inhibit viral entry through endocytic pathway. [Ref.33750821]Virus:SARS-CoV-2:inhibition of replication in high salt condition(IC50?=?0.3?g/ml) [Ref.33750821]no obvious hemolysis was observed when turkey red blood cells were treated at 200?g/ml. Branched Free Free None L [Ref.33750821]Vero-E6 cells:the cytotoxicity indicated that TC50 of 8P9R was higher than 200?g/ml. Not found 33750821 Nat Commun. 2021 Mar 9;12(1):1517. "Zhao H, To KKW, Lam H, Zhou X, Chan JF, Peng Z, Lee ACY, Cai J, Chan WM, Ip JD, Chan CC, Yeung ML, Zhang AJ, Chu AWH, Jiang S, Yuen KY." Cross-linking peptide and repurposed drugs inhibit both entry pathways of SARS-CoV-2. DRAMP29179 ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 35 "IPB01(SARS-CoV-S (1151-1185),SR9, SARS-CoV-2-S (1169-1203))" "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Alpha helix Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=0.0220.005 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=33.7411.827 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M).##[Ref.17942557]Virus:SARS-CoV:Inhibition of virus entry in VERO-E6 cells(EC50=0.005 ?M).##[Ref.18442051]Virus:SARS-CoV: inhibition of PsV entry in Vero-E6 cells(EC50=0.34 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented liposomes 17942557##18442051##32376627 J Virol. 2008 Jan;82(1):588-92.##J Cell Biochem. 2008 Aug 15;104(6):2335-47.##J Virol. 2020 Jul 1;94(14):e00635-20. "Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F. ##Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM. ##Zhu Y, Yu D, Yan H, Chong H, He Y." "Heptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.##Fusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.##Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29180 ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELK 36 IPB02(SARS-CoV-2-S (1169-1203)-K) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Alpha helix Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=0.025 0.002 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=0.080.017 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC=0.251 0.118 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29181 INASVVNIQKEIDRLNEVAKNLNESLIDLQELGK 34 IPB03(SARS-CoV-2-S (1172-1205)) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Alpha helix Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=0.015 0.002 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=0.947 0.179 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC=1.315 0.463 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29182 SVVNIQKEIDRLNEVAKNLNESLIDLQELGK 31 IPB04(SARS-CoV-2-S (1175-1205)) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Alpha helix Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=0.033 0.013 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=0.218 0.063 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC=1.053 0.444 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29183 IQKEIDRLNEVAKNLNESLIDLQELGK 27 IPB05(SARS-CoV-2-S (1179-1205)) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50>5 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>25 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC>25 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29184 IDRLNEVAKNLNESLIDLQELGK 23 IPB06(SARS-CoV-2-S (1183-1205)) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50>5 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>25 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC>25 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29185 IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 33 IPB07(SARS-CoV-2-S (1179-1211)) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Alpha helix Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=0.017 0.001 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=0.993 0.08 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC=1.037 0.836 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29186 ISGINASVVNIQKEIDRLNEVAKNLNESLIK 31 IPB08(SARS-CoV-2-S (1169-1198)-K) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=4.66 1.565 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=1.738 0.898 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC=1.13 0.472 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29187 SVVNIQKEIDRLNEVAKNLNESLIK 25 IPB09(SARS-CoV-2-S (1175-1198)-K) "P59594,P0DTC2" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None "Mechanism of action:The peptide was designed based on HR2 sequence lipopeptide fusion inhibitor,which showed highly potent activities in inhibiting SARS-CoV-2 S protein-mediated cell-cell fusion and pseudovirus transduction. It can also inhibit the SARS-CoV pseudovirus efficiently." "[Ref.32376627]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50>5 ?M),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>25 ?M);##SARS-CoV:inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC>25 ?M);##Vesicular Stomatitis Virus (VSV):inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50>50 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 32376627 J Virol. 2020 Jul 1;94(14):e00635-20. "Zhu Y, Yu D, Yan H, Chong H, He Y." "Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity." DRAMP29188 DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVR 85 AHB1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding. [Ref.32907861]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=35 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32907861 Science. 2020 Oct 23;370(6515):426-431. "Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D. " De novo design of picomolar SARS-CoV-2 miniprotein inhibitors. DRAMP29189 ELEEQVMHVLDQVSELAHELLHKLTGEELERAAYFNWWATEMMLELIKSDDEREIREIEEEARRILEHLEELARK 75 AHB2 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding. [Ref.32907861]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=15.5 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32907861 Science. 2020 Oct 23;370(6515):426-431. "Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D. " De novo design of picomolar SARS-CoV-2 miniprotein inhibitors. DRAMP29190 DKEWILQKIYEIMRLLDELGHAEASMRVSDLIYEFMKKGDERLLEEAERLLEEVER 56 LCB1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding. [Ref.32907861]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=23.54 pM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32907861 Science. 2020 Oct 23;370(6515):426-431. "Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D. " De novo design of picomolar SARS-CoV-2 miniprotein inhibitors. DRAMP29191 NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLS 64 LCB3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding. [Ref.32907861]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=48.1 pM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32907861 Science. 2020 Oct 23;370(6515):426-431. "Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D. " De novo design of picomolar SARS-CoV-2 miniprotein inhibitors. DRAMP29192 TFLDKFNHEAEDLFYQ 16 ACE2 (27-42)(SAP1) Q9BYF1 Belongs to the peptidase M2 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50=2.390.20 mM);Inhibition of infection in 293T/ACE2/GFP cells(IC50=3 mM);##SARS-CoV:Inhibition of infection in 293T/ACE2 cells(80% inhibition at 3 mM);##Vesicular Stomatitis Virus (VSV):No nhibition of infection in 293T/ACE2 cells up to 3 mM;##HCoV-NL63:Inhibition of cytopathic effect in LLC-MK2 cells(30% Inhibition at 3 mM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29193 EDLFYQSSL 9 ACE2 (37-45)(SAP2) Q9BYF1 Belongs to the peptidase M3 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50=3.720.37 mM) No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29194 LAQMYPL 7 ACE2 (79-85)(SAP3) Q9BYF1 Belongs to the peptidase M4 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50>7.5 mM) No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29195 GKGDFRIL 8 ACE2 (352-359)(SAP4) Q9BYF1 Belongs to the peptidase M5 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50>7.5 mM) No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29196 QAKTFLDKFNHEA 13 ACE2 (24-36)(SAP5) Q9BYF1 Belongs to the peptidase M6 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50>7.5 mM);No nhibition of infection in 293T/ACE2/GFP cells up to 3 mM;##SARS-CoV:Inhibition of infection in 293T/ACE2 cells(30% inhibition at 3 mM);##Vesicular Stomatitis Virus (VSV):No nhibition of infection in 293T/ACE2 cells up to 3 mM. No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29197 EDLFYQ 6 ACE2 (37-42)(SAP6) Q9BYF1 Belongs to the peptidase M4 family. ACE2 Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:Inhibiting SARS-CoV-2 infection by disrupting the Spike-ACE2 interaction interface with peptide-based inhibitors. [Ref.33356169]Virus:##SARS-CoV-2:Inhibition of infection in 293T/ACE2 cells(IC50=1.90.14 mM);Inhibition of infection in 293T/ACE2/GFP cells(IC50=3 mM);##SARS-CoV:Inhibition of infection in 293T/ACE2 cells(85% inhibition at 3 mM);##Vesicular Stomatitis Virus (VSV):No nhibition of infection in 293T/ACE2 cells up to 3 mM;##HCoV-NL63:Inhibition of cytopathic effect in LLC-MK2 cells(30% Inhibition at 3 mM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 33356169 Bioconjug Chem. 2021 Jan 20;32(1):215-223. "Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma A." Rationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2. DRAMP29198 DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGC 42 SARS-CoV-2-S(1168C1203)-GSGSGC P0DTC2 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2. "[Ref.33082259]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T cells(IC50=108 nM,IC90=9857 nM),inhibition of infection in Vero E6 cells(IC50~ 6 nM);##SARS-CoV-2_D614G:ihibition of cell-cell fusion in 293T cells(IC50=84 nM,IC90=9650 nM);##SARS-CoV-2_S943P:ihibition of cell-cell fusion in 293T cells(IC50=64 nM,IC90=7542 nM);##SARS-CoV-2_S247R:ihibition of cell-cell fusion in 293T cells(IC50=97 nM,IC90=7859 nM);##MERS-CoV:ihibition of cell-cell fusion in 293T cells(IC50=3510 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 3 nM);##SARS-CoV-1:ihibition of cell-cell fusion in 293T cells(IC50=75 nM,IC90=436 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L "[Ref.33082259]Human embryonic kidney HEK293T cells:18% Cytotoxicity at 10 ?M;Vero E6 cells:12% Cytotoxicity at 1 ?M,30% Cytotoxicity at 10 ?M;Human airway epithelial cells:25% Cytotoxicity at 1 ?M." liposomes 33082259##33597220 mBio. 2020 Oct 20;11(5):e01935-20.##Science. 2021 Mar 26;371(6536):1379-1382. "Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M.##de Vries RD, Schmitz KS, Bovier FT, Predella C, Khao J, Noack D, Haagmans BL, Herfst S, Stearns KN, Drew-Bear J, Biswas S, Rockx B, McGill G, Dorrello NV, Gellman SH, Alabi CA, de Swart RL, Moscona A, Porotto M." Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain.##Intranasal fusion inhibitory lipopeptide prevents direct-contact SARS-CoV-2 transmission in ferrets. DRAMP29199 SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGSGSGC 42 MERS-CoV-HR2P-GSGSGC "R9UQ53,K9N5Q8" Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2. "[Ref.33082259]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T cells(IC50>650 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 36 nM);##SARS-CoV-2_D614G:ihibition of cell-cell fusion in 293T cells(IC50=1000 nM,IC90>1000 nM);##SARS-CoV-2_S943P:ihibition of cell-cell fusion in 293T cells(IC50>1000,IC90>1000 nM);##SARS-CoV-2_S247R:ihibition of cell-cell fusion in 293T cells(IC50>700 nM,IC90>1000 nM);##MERS-CoV:ihibition of cell-cell fusion in 293T cells(IC50=417180 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 4 nM);##SARS-CoV-1:ihibition of cell-cell fusion in 293T cells(IC50=4034 nM,IC90>700 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L [Ref.33082259]Human embryonic kidney HEK293T cells:<10% Cytotoxicity at 10 ?M;Vero E6 cells:12% Cytotoxicity at 10 ?M. liposomes 33082259 mBio. 2020 Oct 20;11(5):e01935-20. "Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M." Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain. DRAMP29200 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGC 42 EK1-GSGSGC Q8BB25 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Hemology Not found Not found None Mechanism of action:The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2. "[Ref.33082259]Virus:##SARS-CoV-2:ihibition of cell-cell fusion in 293T cells(IC50=29360 nM,IC90>900 nM),inhibition of infection in Vero E6 cells(IC50~ 41 nM);##SARS-CoV-2_D614G:ihibition of cell-cell fusion in 293T cells(IC50=261136 nM,IC90=892100 nM);##SARS-CoV-2_S943P:ihibition of cell-cell fusion in 293T cells(IC50=286104 nM,IC90>1000 nM);##SARS-CoV-2_S247R:ihibition of cell-cell fusion in 293T cells(IC50=194107 nM,IC90=89377 nM);##MERS-CoV:ihibition of cell-cell fusion in 293T cells(IC50>1000 nM,IC90>1000 nM),inhibition of infection in Vero E6 cells(IC50~ 2 nM);##SARS-CoV-1:ihibition of cell-cell fusion in 293T cells(IC50=365 nM,IC90>1000 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L [Ref.33082259]Human embryonic kidney HEK293T cells:<5% Cytotoxicity at 10 ?M;Vero E6 cells:18% Cytotoxicity at 10 ?M. liposomes 33082259 mBio. 2020 Oct 20;11(5):e01935-20. "Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M." Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain. DRAMP29201 ANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQ 42 SARS-CoV-2 HR1P P0DTC2 Belongs to the betacoronaviruses spike protein family. S Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Protein level Not found Not found None Mechanism of action:The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection. "[Ref.32047258]Virus:SARS-CoV-2(No inhibition of cell-cell fusion up to 40 ?M in Huh-7 cells,No inhibition of infection up to 40 ?M in 293T/ACE2 cells)" No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32047258 Cell Mol Immunol. 2020 Jul;17(7):765-767. "Xia S, Zhu Y, Liu M, Lan Q, Xu W, Wu Y, Ying T, Liu S, Shi Z, Jiang S, Lu L." Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein. DRAMP29202 PHSCN 5 ATN-161 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide inhibits the spike protein interaction with 51 integrin and the interaction between 51 integrin and ACE2. [Ref.33102950]Virus:SARS-CoV-2:inhibition of replication In VeroE6 cells(IC50=3.16 ?M). No hemolysis information or data found in the reference(s) presented in this entry Linear Acylation Amidation None L No cytotoxicity information found in the reference(s) presented Not found 33102950 JACC Basic Transl Sci. 2021 Jan;6(1):1-8. "Beddingfield BJ, Iwanaga N, Chapagain PP, Zheng W, Roy CJ, Hu TY, Kolls JK, Bix GJ." "The Integrin Binding Peptide, ATN-161, as a Novel Therapy for SARS-CoV-2 Infection." DRAMP29203 RVKR 4 CMK No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:CMK blocks virus entry, but it further suppresses cleavage of spikes and the syncytium." "[Ref.33007239]Virus:SARS-CoV-2:inhibition of virus production in Vero E6 cells(IC50=0.057 ?M).##[Ref.31683742]Virus:Zika virus (ZIKV):inhibition of virus release in Vero cells(IC50=18.59 ?M);Japanese encephalitis virus (JEV):inhibition of virus release in BHK-21 cells(IC50=19.91 ?M).##[Ref.23617302]Virus:Hepatitis B virus (HBV):Inhibition of HBeAg secretion in HepG2.2.15 cells(2611% inhibition at 20 ?M,2113% Inhibition at 100 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Linear Decanoyl(C10) chloromethylketone(CMK) None L [Ref.31683742]Vero cells:CC50=712.9 ?M.[Ref.33007239]Vero E6 cells:IC50=318.2 ?M. Not found 23617302##31683742##33007239 Liver Int. 2013 Sep;33(8):1230-8. ##Viruses. 2019 Oct 31;11(11):1011.##Cell Rep. 2020 Oct 13;33(2):108254. "Pang YJ, Tan XJ, Li DM, Zheng ZH, Lei RX, Peng XM.##Imran M, Saleemi MK, Chen Z, Wang X, Zhou D, Li Y, Zhao Z, Zheng B, Li Q, Cao S, Ye J.##Cheng YW, Chao TL, Li CL, Chiu MF, Kao HC, Wang SH, Pang YH, Lin CH, Tsai YM, Lee WH, Tao MH, Ho TC, Wu PY, Jang LT, Chen PJ, Chang SY, Yeh SH." Therapeutic potential of furin inhibitors for the chronic infection of hepatitis B virus.##Decanoyl-Arg-Val-Lys-Arg-Chloromethylketone: An Antiviral Compound That Acts against Flaviviruses through the Inhibition of Furin-Mediated prM Cleavage.##Furin Inhibitors Block SARS-CoV-2 Spike Protein Cleavage to Suppress Virus Production and Cytopathic Effects. DRAMP29204 LQTALYALMEEIHIAALEKTWTALRHQYT 29 Covid3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acts as an inhibitor of the RBDCACE2 interaction [Ref.34624194]Virus:##SARS-CoV-2:inhibition of infection in Vero cells(IC50=6.56 2.14 M);##SARS-CoV-2 variants B.1.1.7:inhibition of infection in Vero cells(IC50=33.40 10.75 M);##SARS-CoV-2 variants B.1.351:inhibition of infection in Vero cells(IC50=11.13 3.82 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Acylation Amidation None D No cytotoxicity information found in the reference(s) presented Not found 34624194 J Med Chem. 2021 Oct 28;64(20):14955-14967. "Valiente PA, Wen H, Nim S, Lee J, Kim HJ, Kim J, Perez-Riba A, Paudel YP, Hwang I, Kim KD, Kim S, Kim PM. " Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2. DRAMP29205 RFDGKGLGIYQYMEEIEHAASRFAYFFYQHLA 32 Covid_extented_1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The peptide acts as an inhibitor of the RBDCACE2 interaction [Ref.34624194]Virus:##SARS-CoV-2:inhibition of infection in Vero cells(IC50=5.76 1.65 M);##SARS-CoV-2 variants B.1.1.7:inhibition of infection in Vero cells(IC50=5.57 4.04 M);##SARS-CoV-2 variants B.1.351:inhibition of infection in Vero cells(IC50=7.37 1.80 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Acylation Amidation None D No cytotoxicity information found in the reference(s) presented Not found 34624194 J Med Chem. 2021 Oct 28;64(20):14955-14967. "Valiente PA, Wen H, Nim S, Lee J, Kim HJ, Kim J, Perez-Riba A, Paudel YP, Hwang I, Kim KD, Kim S, Kim PM. " Computational Design of Potent D-Peptide Inhibitors of SARS-CoV-2. DRAMP29206 SALEEQYKTFLDKFLHELEDLLYQLALAL 29 P7 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:The peptide was designed mimicking the N-terminal helix of hACE2 protein,which could prevent the SARS-CoV-2 from infecting human cells, blocking the interaction between hACE2 and the virus spike protein." [Ref.33580154]Virus:SARS-CoV-2:54% inhibition of replication in Vero-E6 cells at 10?M;inhibition of replication in Calu-3 cells(IC50>1 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Amidation None L No cytotoxicity information found in the reference(s) presented Not found 33580154 Commun Biol. 2021 Feb 12;4(1):197. "Karoyan P, Vieillard V, Gmez-Morales L, Odile E, Guihot A, Luyt CE, Denis A, Grondin P, Lequin O." Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection. DRAMP29207 SALEEQLKTFLDKFMHELEDLLYQLAL 27 P8 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Alpha helix Not found None "Mechanism of action:The peptide was designed mimicking the N-terminal helix of hACE2 protein,which could prevent the SARS-CoV-2 from infecting human cells, blocking the interaction between hACE2 and the virus spike protein." [Ref.33580154]Virus:SARS-CoV-2:91% inhibition of replication in Vero-E6 cells at 10?M;inhibition of replication in Calu-3 cells(IC50=46 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Amidation None L [Ref.33580154]The peptide proved to be devoid of cell toxicity on Vero-E6 and Calu-3 cells. Not found 33580154 Commun Biol. 2021 Feb 12;4(1):197. "Karoyan P, Vieillard V, Gmez-Morales L, Odile E, Guihot A, Luyt CE, Denis A, Grondin P, Lequin O." Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection. DRAMP29208 SALEEQYKTFLDKFMHELEDLLYQLSL 27 P9 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:The peptide was designed mimicking the N-terminal helix of hACE2 protein,which could prevent the SARS-CoV-2 from infecting human cells, blocking the interaction between hACE2 and the virus spike protein." [Ref.33580154]Virus:SARS-CoV-2:93% inhibition of replication in Vero-E6 cells at 10?M;inhibition of replication in Calu-3 cells(IC50=53 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Amidation None L [Ref.33580154]The peptide proved to be devoid of cell toxicity on Vero-E6 and Calu-3 cells. Not found 33580154 Commun Biol. 2021 Feb 12;4(1):197. "Karoyan P, Vieillard V, Gmez-Morales L, Odile E, Guihot A, Luyt CE, Denis A, Grondin P, Lequin O." Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection. DRAMP29209 SALEEQYKTFLDKFMHELEDLLYQLAL 27 P10 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:The peptide was designed mimicking the N-terminal helix of hACE2 protein,which could prevent the SARS-CoV-2 from infecting human cells, blocking the interaction between hACE2 and the virus spike protein." [Ref.33580154]Virus:SARS-CoV-2:95% inhibition of replication in Vero-E6 cells at 10?M;inhibition of replication in Calu-3 cells(IC50=42 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Amidation None L [Ref.33580154]The peptide proved to be devoid of cell toxicity on Vero-E6 and Calu-3 cells. Not found 33580154 Commun Biol. 2021 Feb 12;4(1):197. "Karoyan P, Vieillard V, Gmez-Morales L, Odile E, Guihot A, Luyt CE, Denis A, Grondin P, Lequin O." Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection. DRAMP29210 RGAHIKGRWKSRCHRF 16 FBP No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None The fusion-inhibition peptide FBP could broadly inhibit influenza virus and SARS-CoV-2 by interfering the viral fusion by the endocytic pathway and showed potently antiviral activity against the influenza virus in mice and SARS-CoV-2 variants in hamsters. "[Ref.35259078]Virus:A(H1N1)(IC50?=?3.9 g/ml);A(H3N2)(IC50?=?1.6 g/ml);FluB (IC50?=?7.1 g/ml);SARS-CoV-2 (HKU001a):inhibition of infection in Vero-E6 cells(IC50=2.9 g/ml);SARS-CoV-2 (B.1.1.63, D614G):inhibition of infection in Vero-E6 cells(IC50=3.0 g/ml);SARS-CoV-2(Delta):inhibition of infection in Vera-E6 cells(IC50=3.9 g/ml)." [Ref.35259078]No significant hemolysis against Turkey red blood cells (RBC). Linear Free Free None L [Ref.35259078]No significant cytotoxicity was detected in MDCK(Madin Darby canine kidney) cells at 1 mg/ml(TC50?>?1?mg/ml). liposomes 35259078 Emerg Microbes Infect. 2022 Dec;11(1):926-937. "Zhao H, Meng X, Peng Z, Lam H, Zhang C, Zhou X, Chan JF, Kao RYT, To KK, Yuen KY." "Fusion-inhibition peptide broadly inhibits influenza virus and SARS-CoV-2, including Delta and Omicron variants." DRAMP29211 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1P4HC No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "The peptide targets two different sites when mediating virusCcell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level." [Ref.34769299]Virus:##SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.8 M);##SARS-CoV-2 B.1.1.7 (Alpha):inhibition of Pseudoviruse infection in Caco2 cells(IC50=2.28 M);##SARS-CoV-2 B.1.351 (Beta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.62 M);##SARS-CoV-2 P.1 (Gamma):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.48 M);##SARS-CoV-2 B.1.617.2 (Delta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.11 M);##HCoV-229E(Authentic):inhibition of infection in Caco2 cells(IC50=0.48 M);##HCoV-OC43(Authentic):inhibition of infection in Caco2 cells(IC50=0.41 M);##SARS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.35 M);##MERS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.10 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-25-HC None L [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 M. liposomes 34769299 Int J Mol Sci. 2021 Nov 1;22(21):11869. "Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S. " "25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses." DRAMP29212 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1P8HC No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "The peptide targets two different sites when mediating virusCcell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level." [Ref.34769299]Virus:SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=3.7 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-25-HC None L [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 M. liposomes 34769299 Int J Mol Sci. 2021 Nov 1;22(21):11869. "Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S. " "25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses." DRAMP29213 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1P12HC No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "The peptide targets two different sites when mediating virusCcell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level." [Ref.34769299]Virus:SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=5.2 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG12-25-HC None L [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 M. liposomes 34769299 Int J Mol Sci. 2021 Nov 1;22(21):11869. "Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S. " "25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses." DRAMP29214 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG 41 EK1P24HC No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "The peptide targets two different sites when mediating virusCcell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level." [Ref.34769299]Virus:SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=10.3 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG24-25-HC None L [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 M. liposomes 34769299 Int J Mol Sci. 2021 Nov 1;22(21):11869. "Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S. " "25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses." DRAMP29215 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP20 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 48% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=1.36 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=50.52 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=33.85 nM);##SARS-CoV-2 D614G:inhibition of pseudovirus infections in Huh-7 cells(IC50=103.17 nM);##SARS-CoV-2 N501Y:inhibition of pseudovirus infections in Huh-7 cells(IC50=128.87 nM);##SARS-CoV-2 H69-V70:inhibition of pseudovirus infections in Huh-7 cells(IC50=111.41 nM);##SARS-CoV-2 E484K:inhibition of pseudovirus infections in Huh-7 cells(IC50=79.09 nM);##SARS-CoV-2 B.1.1.7:inhibition of pseudovirus infections in Huh-7 cells(IC50=88.49 nM);##SARS-CoV-2 B.1.351:inhibition of pseudovirus infections in Huh-7 cells(IC50=92.16 nM);##SARS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=73.86 nM);##MERS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=228.4 nM);##HCoV-NL63:inhibition of pseudovirus infections in Huh-7 cells(IC50=817.21 nM);##HCoV-229E:inhibition of pseudovirus infections in Huh-7 cells(IC50=471.54 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol(cholesterol) None L No cytotoxicity information found in the reference(s) presented Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29216 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP21 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=7.5 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=191.4 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=126.65 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free C16(palmitic acid) None L No cytotoxicity information found in the reference(s) presented Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29217 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP22 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=6.23 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=179.95 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=86.33 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free C18(stearic acid) None L No cytotoxicity information found in the reference(s) presented Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29218 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP23 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=39.07 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=1236.38 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=507.32 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Toc(tocophenol) None L No cytotoxicity information found in the reference(s) presented Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29219 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP24 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 16% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.33 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=3.77 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=2.89 nM);inhibition of live SARS-CoV-2 infection in Vero cells(IC50=8.97 nM);##SARS-CoV-2 D614G:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.29 nM);##SARS-CoV-2 N501Y:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.5 nM);##SARS-CoV-2 H69-V70:inhibition of pseudovirus infections in Huh-7 cells(IC50=7.42 nM);##SARS-CoV-2 E484K:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.97 nM);##SARS-CoV-2 B.1.1.7:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.22 nM);##SARS-CoV-2 B.1.351:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.06 nM);##SARS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=21.64 nM);##MERS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=69.9 nM);##HCoV-NL63:inhibition of pseudovirus infections in Huh-7 cells(IC50=375.56 nM);##HCoV-229E:inhibition of pseudovirus infections in Huh-7 cells(IC50=421.48 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG4-K(Chol) None L [Ref.34057039]Huh-7 cells:CC50=6.6 M;Vero-E6 cells:CC50=13.67 M. Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29220 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP25 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 18% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." "[Ref.34057039]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.29 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=2.13 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=1.43 nM),inhibition of live SARS-CoV-2 infection in Vero cells(IC50=25.71 nM);##SARS-CoV-2 D614G:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.8 nM);##SARS-CoV-2 N501Y:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.52 nM);##SARS-CoV-2 H69-V70:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.56 nM);##SARS-CoV-2 E484K:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.71 nM);##SARS-CoV-2 B.1.1.7:inhibition of pseudovirus infections in Huh-7 cells(IC50=5.87 nM);##SARS-CoV-2 B.1.351:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.76 nM);##SARS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=17.69 nM);##MERS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=48.5 nM);##HCoV-NL63:inhibition of pseudovirus infections in Huh-7 cells(IC50=353.22 nM);##HCoV-229E:inhibition of pseudovirus infections in Huh-7 cells(IC50=336.14 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG5-K(Chol) None L [Ref.34057039]Huh-7 cells:CC50=3.54 M;Vero-E6 cells:CC50=6.95 M. Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29221 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP26 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." [Ref.34057039]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.26 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=3.05 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=1.82 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG6-K(Chol) None L No cytotoxicity information found in the reference(s) presented Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29222 SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK 37 IBP27 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 12% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None "Mechanism of action:Peptides derived from HR2 sequences of viral fusion proteins, including the S protein of emerging CoVs, can competitively bind to the HR1 domain and block the formation of the viral 6-HB core, thereby inhibiting infection of the virus from which they were derived." "[Ref.34057039]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.32 nM);inhibition of pseudovirus infections in 293T/ACE2 cells(IC50=2.77 nM);inhibition of pseudovirus infections in Huh-7 cells(IC50=1.54 nM),inhibition of live SARS-CoV-2 infection in Vero cells(IC50=29.85 nM);##SARS-CoV-2 D614G:inhibition of pseudovirus infections in Huh-7 cells(IC50=6.75 nM);##SARS-CoV-2 N501Y:inhibition of pseudovirus infections in Huh-7 cells(IC50=7.87 nM);##SARS-CoV-2 H69-V70:inhibition of pseudovirus infections in Huh-7 cells(IC50=7.56 nM);##SARS-CoV-2 E484K:inhibition of pseudovirus infections in Huh-7 cells(IC50=7.55 nM);##SARS-CoV-2 B.1.1.7:inhibition of pseudovirus infections in Huh-7 cells(IC50=7.18 nM);##SARS-CoV-2 B.1.351:inhibition of pseudovirus infections in Huh-7 cells(IC50=8.25 nM);##SARS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=24.95 nM);##MERS-CoV:inhibition of pseudovirus infections in Huh-7 cells(IC50=60.08 nM);##HCoV-NL63:inhibition of pseudovirus infections in Huh-7 cells(IC50=179.53 nM);##HCoV-229E:inhibition of pseudovirus infections in Huh-7 cells(IC50=231.18 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34057039]Huh-7 cells:CC50=4.04 M;Vero-E6 cells:CC50=5.05 M. Not found 34057039 Emerg Microbes Infect. 2021 Dec;10(1):1227-1240. "Yu D, Zhu Y, Jiao T, Wu T, Xiao X, Qin B, Chong H, Lei X, Ren L, Cui S, Wang J, He Y." Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. DRAMP29223 ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 35 IBP02V1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 0% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=1.10.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in 293T/ACE2 cells(IC50=17.8 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=14.3 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.60.1 nM);inhibition of pseudovirus infection in 293T/ACE2 cells(IC50=50 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=21.5 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=33.63.5 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=66.97.6 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=62.517.2 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=203.98.8 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34344868]No significant cytotoxicity in both 293T/ACE2 and Huh-7 cells at a concentration of 10?M. liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29224 DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 36 IBP02V2 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 22% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.60.03 nM);inhibition of SARS-CoV-2 pseudovirus infection in 293T/ACE2 cells(IC50=20.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=18.1 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.40.04 nM);inhibition of pseudovirus infection in 293T/ACE2 cells(IC50=19.3 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=20.8 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=56.59.4nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=55.32.8 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=67.58 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=535.744.6 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34344868]No significant cytotoxicity in both 293T/ACE2 and Huh-7 cells at a concentration of 10?M. liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29225 EISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 36 IBP02V3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 48% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.40.02 nM);inhibition of SARS-CoV-2 pseudovirus infection in 293T/ACE2 cells(IC50=14.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=17.5 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.20.02 nM);inhibition of pseudovirus infection in 293T/ACE2 cells(IC50=40.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=14.4 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=485.8 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=38.56.2 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=75.89.9 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=545.70.9 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34344868]No significant cytotoxicity in both 293T/ACE2 and Huh-7 cells at a concentration of 10?M. liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29226 ELSGINASVVNLQKEIDRLNEVAKNLNESLIDLQEL 36 IBP02V4 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 59% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.30.02 nM);inhibition of SARS-CoV-2 pseudovirus infection in 293T/ACE2 cells(IC50=18.6 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=15.2 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.10.02 nM);inhibition of pseudovirus infection in 293T/ACE2 cells(IC50=29.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=26.3 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=631.7 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=22.42.2 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=66.33.1 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=50224.2 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34344868]No significant cytotoxicity in both 293T/ACE2 and Huh-7 cells at a concentration of 10?M. liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29227 SLTQINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 36 IBP02V5 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 16% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=2.10.5 nM);inhibition of SARS-CoV-2 pseudovirus infection in 293T/ACE2 cells(IC50=21 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=23.5 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=1.30.1 nM);inhibition of pseudovirus infection in 293T/ACE2 cells(IC50=98.8 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=27.5 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=65.913.2 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=68.49.7 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=70.88.7 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=1128.4148.6 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L [Ref.34344868]No significant cytotoxicity in both 293T/ACE2 and Huh-7 cells at a concentration of 10?M. liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29228 SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL 36 MERS-LP No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 8% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=102.97.2 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=5046905.2 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=79.19.8 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=82.98.6 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50>25000 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L No cytotoxicity information found in the reference(s) presented liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29229 SLDYINVTFLDLQDEMNRLQEAIKVLNQSYINLKDI 36 OC43-LP No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 22% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=4.11 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=82.822.1 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=2.40.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=97.55.9 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=250.439.7 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=5.20.5 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=416.5227.5 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=2008.8697.9 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L No cytotoxicity information found in the reference(s) presented liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29230 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELK 37 EK1V1 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 39% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37 C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=273.54.1 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=2672.1384.5 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=214.520.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=1790.8363.2 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=4370.3719.7 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=499.8163.3 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=487.241.3 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=1255.6453.3 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Chol None L No cytotoxicity information found in the reference(s) presented liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29231 SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL 36 EK1V2 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found 68% -helicity in phosphate-buffered saline (PBS; pH 7.2) with a final concentration of 10 M and incubated at 37C Not found None The peptide is a fusion inhibitor against SARS-CoV-2. [Ref.34344868]Virus:##SARS-CoV-2:inhibition of SARS-CoV-2 S protein-mediated cell-cell fusion(IC50=0.90.2 nM);inhibition of SARS-CoV-2 pseudovirus infection in Huh-7 cells(IC50=87.28.3 nM);##SARS-CoV-2 D614G:inhibition of S protein-mediated cell-cell fusion(IC50=0.50.2 nM);inhibition of pseudovirus infection in Huh-7 cells(IC50=106.55.4 nM);##SARS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=2525.6 nM);##MERS-CoV:inhibition of pseudovirus infection in Huh-7 cells(IC50=1.10.3 nM);##HCoV-NL63:inhibition of pseudovirus infection in Huh-7 cells(IC50=59.413.1 nM);##HCoV-229E:inhibition of pseudovirus infection in Huh-7 cells(IC50=503.320.9 nM). No hemolysis information or data found in the reference(s) presented in this entry Linear Free PEG8-K(Chol) None L No cytotoxicity information found in the reference(s) presented liposomes 34344868 Signal Transduct Target Ther. 2021 Aug 3;6(1):294. "Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y." SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. DRAMP29232 ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL 35 P3 No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Comment: No comments found on DRAMP database [Ref.32482145]Virus:HCoV-19:inhibition of HCoV-19 S mediated cellCcell fusion(EC50=0.72 M);neutralizing activities against pseudotype HCoV-19 virus(EC50=0.32 M);inhibition of authentic HCoV-19 virus infection in Vero E6 cells(EC50=0.58 M). No hemolysis information or data found in the reference(s) presented in this entry Linear Free Free None L No cytotoxicity information found in the reference(s) presented Not found 32482145 Emerg Microbes Infect. 2020 Dec;9(1):1238-1241. "Sun H, Li Y, Liu P, Qiao C, Wang X, Wu L, Liu K, Hu Y, Su C, Tan S, Zou S, Wu G, Yan J, Gao GF, Qi J, Wang Q. " Structural basis of HCoV-19 fusion core and an effective inhibition peptide against virus entry. DRAMP29233 XxXVXAaXXXX 11 "Alisporivir, Debio-025" No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Comment: No comments found on DRAMP database "[Ref.32376613]Virus:SARS-CoV-2:Inhibition of infection in Vero E6 cells(EC50=0.460.04 ?M,E90=3.101.40 M).##[Ref.32568027]Virus:##SARS-CoV-2:Inhibition of infection in Vero E6 cells(EC50=4.91.3 ?M);##SARS-CoV:Inhibition of infection in Vero E6 cells(EC50=4.31.0 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic No specific N-terminal No specific C-terminal "The 'X' at position 1 is alpha-aminobutyric acid,position 2 is N-methylalanine,the 'V' at position 3 is N-methylalanine,the 'X' at position 5,8,9 are N-methylleucine,the 'X' at position 10 is N-methylvaline and position 11 is N-methyl-(4R)-4-[(E)-but-2-enyl]-4-methyl-L-threonyl" "Mixed(D-Ala7,D-meth-Ala2)" [Ref.32376613]Vero E6 cells:CC50>20?M. Not found 32376613##32568027 Antimicrob Agents Chemother. 2020 Jun 23;64(7):e00876-20. ##J Gen Virol. 2020 Sep;101(9):925-940. "Softic L, Brillet R, Berry F, Ahnou N, Nevers Q, Morin-Dewaele M, Hamadat S, Bruscella P, Fourati S, Pawlotsky JM, Ahmed-Belkacem A.##Ogando NS, Dalebout TJ, Zevenhoven-Dobbe JC, Limpens RWAL, van der Meer Y, Caly L, Druce J, de Vries JJC, Kikkert M, Brcena M, Sidorov I, Snijder EJ." "Inhibition of SARS-CoV-2 Infection by the Cyclophilin Inhibitor Alisporivir (Debio 025).##SARS-coronavirus-2 replication in Vero E6 cells: replication kinetics, rapid adaptation and cytopathology." DRAMP29234 PxTXXLPX 8 "Plitidepsin, Aplidine" No entry found Not found Not found Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" Not found Not found Not found None Mechanism of action:The antiviral activity of plitidepsin against SARS-CoV-2 is mediated through inhibition of the known target eEF1A (eukaryotic translation elongation factor 1A). "[Ref.33495306]Virus:SARS-CoV-2:inhibition of replication In Vero E6 cells(IC50=0.70 nM,IC90=1.76 nM);inhibition of replication In hACE2-HEK293T cells(IC50=0.73 nM,IC90=0.88 nM);inhibition of replication In pneumocyte-like cells(IC50=1.62 nM,IC90=3.14 nM).##[Ref.35231500]Virus:##SARS-CoV-2 D614G:inhibition of replication in Vero E6 cells(IC50=5.2 nM);##SARS-CoV-2 Delta:inhibition of replication in Vero E6 cells(IC50=3.9 nM);##SARS-CoV-2 Omicron:inhibition of replication in Vero E6 cells(IC50=4.3 nM)." No hemolysis information or data found in the reference(s) presented in this entry Linear Pyruvoyl Free "The 'X' at position 2 is N-methylleucine,position 4 is 4-amino-3-hydroxy-5-methyl-Heptanoic acid, position 5 is Hydroxyisovalerylpropionyl, and position 8 is N-methyl-4-methyl-tyrosine.There is a Sidechain-Mainchain Bond between position 3 and 8." Mixed(D-meth-Leu2) "[Ref.33495306]Vero E6 cells:CC10=0.36 nM,CC50=1.99 nM;hACE2-293T cells:CC10=2.00 nM,CC50>200 nM;pneumocyte-like cells:CC10=20.88 nM,CC50=65.43 nM." Not found 35231500##33495306 Antiviral Res. 2022 Apr;200:105270.##Science. 2021 Feb 26;371(6532):926-931. "Sachse M, Tenorio R, Fernndez de Castro I, Mu?oz-Basagoiti J, Perez-Zsolt D, Ra?ch-Regu D, Rodon J, Losada A, Avils P, Cuevas C, Paredes R, Segals J, Clotet B, Vergara-Alert J, Izquierdo-Useros N, Risco C.##White KM, Rosales R, Yildiz S, Kehrer T, Miorin L, Moreno E, Jangra S, Uccellini MB, Rathnasinghe R, Coughlan L, Martinez-Romero C, Batra J, Rojc A, Bouhaddou M, Fabius JM, Obernier K, Dejosez M, Guilln MJ, Losada A, Avils P, Schotsaert M, Zwaka T, Vignuzzi M, Shokat KM, Krogan NJ, Garca-Sastre A. " Unraveling the antiviral activity of plitidepsin against SARS-CoV-2 by subcellular and morphological analysis.##Plitidepsin has potent preclinical efficacy against SARS-CoV-2 by targeting the host protein eEF1A.