DRAMP_ID	Sequence	Sequence_Length	Name	Swiss_Prot_Entry	Family	Gene	Source	Activity	Protein_existence	Structure	Structure_Description	PDB_ID	Comments	Target_Organism	Hemolytic_activity	Linear/Cyclic/Branched	N-terminal_Modification	C-terminal_Modification	Other_Modifications	Stereochemistry	Cytotoxicity	Binding_Traget	Pubmed_ID	Reference	Author	Title
DRAMP01746	FVQWFSKFLGRIL	13	"Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)"	P57104	Belongs to the frog skin active peptide (FSAP) family. Brevinin subfamily.	Not found	Rana temporaria (European common frog)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anti-cancer"	Protein level	Alpha helix	Not found	6GS5 resolved by NMR.	"Function: Antibacterial activity against Gram-negative and Gram-positive bacteria.
PTM: Leucine amide at position 13.
Tissue specificity: Expressed by the skin glands."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	9022710	Eur J Biochem. 1996 Dec 15;242(3):788-792.	"Simmaco M, Mignogna G, Canofeni S, Miele R, Mangoni ML, Barra D."	"Temporins, antimicrobial peptides from the European red frog Rana temporaria."
DRAMP02478	IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFP	31	"L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)"	B3EWI9	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).
Tissue specificity: Expressed by the venom gland."	"Gram-positive bacteria: Bacillus subtilis strain ATCC 6633 (MIC=32 ?M), Enterococcus faecalis strain ATCC 12953 (MIC=32 ?M), Staphylococcus aureus strain ATCC 29213 (MIC=32 ?M), Streptococcus pyogenes strain ATCC 19615 (MIC=8 ?M);##Gram-negative bacteria: Escherichia coli strain ATCC 8739 (MIC=4 ?M), Klebsiella pneumoniaee strain ATCC 13885 (MIC=2 ?M), Proteus mirabilis strain ATCC 25933 (MIC=2 ?M), Pseudomonas aeruginosa strain ATCC 15442 (MIC=8 ?M), Salmonella typhimurium strain ATCC 14028 (MIC=8 ?M)."	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	22438972	PLoS One. 2012;7(3):e33639.	"Okubo BM, Silva ON, Migliolo L, Gomes DG, Porto WF, Batista CL, Ramos CS, Holanda HH, Dias SC, Franco OL, Moreno SE."	Evaluation of an antimicrobial L-amino acid oxidase and peptide derivatives from Bothropoides mattogrosensis pitviper venom.
DRAMP18495	QCRRLCYKQRCVTYCRGR	18	"Gomesin (Gm; Spiders, arachnids, Chelicerata, arthropods, invertebrates, animals)"	P82358 	Belongs to the tachyplesin family	Not found	Acanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antimalarial, Antic"	Protein level	Beta sheet	Not found	1KFP resolved by NMR.	"Function: Antimicrobial activity  against Gram-positive bacteria, Gram-negative bacteria and fungi. It shows hemolytic activity.
Tissue specificity: In hemocytes only, but not in all hemocytes observed."	"[Ref.10942757] Gram-positive bacteria: Aerococcus viridans (MIC=0.8-1.6 μM), Bacillus cereus (MIC=6.25-12.5 μM), Bacillus megaterium (MIC=0.2-0.4 μM), Bacillus thuringiensis (MIC=1.6-3.15 μM), Enterococcus faecalis (MIC=6.2-12.5 μM), Listeria monocytogenes (MIC=0.8-1.6 μM), Micrococcus luteus (MIC=0.4-0.8 μM), Pediococcus acidolacrici (MIC=3.15-6.25 μM), Staphylococcus aureus (MIC=1.6-3.15 μM), Staphylococcus epidermidis (MIC=0.8-1.6 μM), Staphylococcus haemolyticus (MIC=0.8-1.6 μM), Staphylococcus saprophyticus (MIC=0.8-1.6 μM), Streptococcus pyogenes (MIC=1.6-3.15 μM), Nocardia asteroides (MIC=1.6-3.15 μM);##Gram-negative bacteria: Escherichia coli 1106 (MIC=0.8-1.6 μM), Escherichia coli D22 (MIC=0.4-0.8 μM), Escherichia coli D31 (MIC=0.8-1.6 μM), Escherichia coli SBS363 (MIC=0.4-0.8 μM), Erwinia carolovora (MIC=3.15-6.25 μM), Enterobacter cloacae β12 (MIC=3.15-6.25 μM), Klebsiella pneumoniae (MIC=3.15-6.25 μM), Pseudomonas aeruginosa (MIC=1.6-3.15 μM), Salmonella thyphinurium (MIC=0.8-1.6 μM), Xhantomonas campestris pv. orizae (MIC=3.15-6.25 μM);##Fungi: Alternaria brassicola (MIC=0.4-0.8 μM), Aspergillus fumigatus (MIC=1.6-3.15 μM), Beauveria bassiana (MIC=12.5-25 μM), Fusarium culmorum (MIC=0.4-0.8 μM), Fusarium oxysporum (MIC=0.4-0.8 μM), Neurospora crassa (MIC=0.4-0.8 μM), Nectria haematococca (MIC=0.2-0.4 μM), Tricoderma viridae (MIC=0.4-0.8 μM), Tricophvton mentagrophytes (MIC=0.8-1.6 μM);##Yeasts: Candida albicans (MIC=0.15-0.3 μM), Candida glabrata (MIC=12.5-25 μM), Candida tropicalis (MIC=3.15-6.25 μM), Cryptococcus neoformans (MIC=0.8-1.6 μM), Saccharomyces cerevisiae (MIC=1.6-3.15 μM)."	[Ref.10942757] It exhibits 16% hemolysis at 1 μM and 100 μM against human erythrocytes	Cyclic	pyroglutamic acid	Amidation	"Disulfide bond between Cys2 and Cys15,Cys6 and Cys11."	L	No cytotoxicity information found	Not found	10942757	J Biol Chem. 2000 Oct 27;275(43):33464-70.	"Silva PI Jr, Daffre S, Bulet P."	"Isolation and characterization of gomesin, an 18-residue cysteine-rich defense peptide from the spider Acanthoscurria gomesiana hemocytes with sequence similarities to horseshoe crab antimicrobial peptides of the tachyplesin family."
DRAMP03150	MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL	61	"Gambicin (Insects, animals)"	No entry found	Not found	Not found	Anopheles albimanus (mosquito)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic"	Not found	Bridge	Not found	None	"Function: In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes.
Induction: Predominantly expressed in the anterior part.
PTM: Contains four disulfide bridges."	Gram-negative bacterium: E. coli (MIC=6.25-12.5 ?M);##Gram-positive bacterium: M. luteus (MIC=25-50 ?M).##Fungus: N. crassa.	No hemolysis information or data found in the reference(s) presented in this entry	Cyclic	Free	Free	"Disulfide bonds between Cys9 and Cys20; Cys12 and Cys32; Cys41 and Cys51,Cys44 and Cys59."	L	No cytotoxicity information found	Not found	11606751	Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.	"Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G."	Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae.
DRAMP03162	ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRR	40	"Phlebotomus duboscqi defensin (PduDef; defensins; Insects, animals)"	P83404	Belongs to the invertebrate defensin family (Type 1 subfamily)	Not found	Phlebotomus duboscqi	"Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiparasitic"	Protein level	Bridge	Not found	None	"Function: Has antiparasitic and antifungal activity.
Tissue specificity: Is synthesized by the fat body and eventually secreted into the hemolymph.
Induction: By bacterial and parasitic hemolymph and gut infections. Expression peaks at 24 hours post infection by bacterium P. carotovorum, and at day four post infection by the parasite L. major. 
PTM: Problely contains three disulfide bonds 3-30; 16-36; 20-36."	"Gram-positive bacteria: Staphylococcus aureus (MIC=0.78-1.56 ?M), Aspergillus fumigatus (MIC=12.5-25 ?M).##Fungi: Fusarium culmorum (MIC=1.56-3.12 ?M), Fusarium oxysporum (MIC=3.12-6.25 ?M), Neurospora crassa (MIC=6.25-12.5 ?M), Trichoderma viride (MIC=3.12-6.25 ?M), Trichophyton mentagrophytes (MIC=25-50 ?M), Candida albicans (MIC=6.25-12.5 ?M), Saccharomyces cerevisiae (MIC=25-50 ?M).##Parasite: Leishmania major promastigote forms (IC50=68-85 ?M)."	No hemolysis information or data found in the reference(s) presented in this entry	Cyclic	Free	Free	Disulfide bonds between Cys3 and Cys30; Cys16 and Cys36; Cys20 and Cys36.	L	No cytotoxicity information found	Not found	15557638	Infect Immun. 2004 Dec;72(12):7140-7146.	"Boulanger N, Lowenberger C, Volf P, Ursic R, Sigutova L, Sabatier L, Svobodova M, Beverley SM, Sp?th G, Brun R, Pesson B, Bulet P."	Characterization of a defensin from the sand fly Phlebotomus duboscqi induced by challenge with bacteria or the protozoan parasite Leishmania major.
DRAMP00252	VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR	51	AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)	No entry found	Not found	Not found	Anaeromyxobacter dehalogenans (Gram-negative bacteria)	"Antibacterial, Antifungal, Antiparasitic, Antimicrobial"	Not found	Not found	"Circular dichroism (CD) analysis indicates that recombinant AdDLP adopts a typical structural feature of eukaryotic defensins, which is also consistent with an ab initio structure model predicted using I-TASSER algorithm."	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	19615342	Biochem Biophys Res Commun. 2009 Sep 18;387(2):393-398.	"Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S."	"AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity."
DRAMP01743	FLPLIGKVLSGIL	13	"Temporin-F (Frogs, amphibians, animals)"	P56921	Belongs to the frog skin active peptide (FSAP) family. Brevinin subfamily.	Not found	Rana temporaria (European common frog)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Antibacterial activity against Gram-negative and Gram-positive  bacteria.
PTM: Leucine amide at position 13.
Tissue specificity: Expressed by the skin glands."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	9022710	Eur J Biochem. 1996 Dec 15;242(3):788-792.	"Simmaco M, Mignogna G, Canofeni S, Miele R, Mangoni ML, Barra D."	"Temporins, antimicrobial peptides from the European red frog Rana temporaria."
DRAMP02310	AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH	33	"HbbetaP-1 (fish, chordates, animals)"	No entry found	Not found	Not found	Ictalurus punctatus (Catfish)	"Antimicrobial, Antibacterial, Antiparasitic"	Not found	Not found	Not found	None	"Function: Showes moderate activity against Gram-negative bacteria, Aeromonas hydrophila and Vibrio alginolyticus, but no activity against Gram-positive bacteria such as S. aureus, Streptococcus faecalis S. iniae."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18538841	Dev Comp Immunol. 2008;32(11):1301-1312. 	"Ullal AJ, Litaker RW, Noga EJ."	"Antimicrobial peptides derived from hemoglobin are expressed in epithelium of channel catfish (Ictalurus punctatus, Rafinesque)."
DRAMP02418	GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK	38	"Longicin (Ticks, Arthropods, animals)"	No entry found	Not found	Not found	Haemaphysalis longicornis (Tick)	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Not found	Not found	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	17485458	Infect Immun. 2007 Jul;75(7):3633-3640.	"Tsuji N, Battsetseg B, Boldbaatar D, Miyoshi T, Xuan X, Oliver JH Jr, Fujisaki K."	Babesial vector tick defensin against Babesia sp. parasites.
DRAMP02435	LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV	58	Antifungal protein (PgAFP; Cys-rich)	"D0EXD3, B6GXZ8"	Not found	afp	Penicillium chrysogenum (Penicillium notatum)	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Has strong antifungal activity against the molds Polytrichum commune Pc332, Penicillium echinulatum Pe321, and Aspergillus niger An261.
PTM: Contains three disulfide bonds (By similarity)."	"Fungi: Polytrichum commune Pc332, Penicillium echinulatum Pe321, Aspergillus niger An261."	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	19914321##19683356	Peptides. 2010 Apr;31(4):541-547.##Int J Food Microbiol. 2009 Sep 30;135(1):39-46.	"Rodríguez-Martín A, Acosta R, Liddell S, Nú?ez F, Benito MJ, Asensio MA.##Acosta R, Rodríguez-Martín A, Martín A, Nú?ez F, Asensio MA."	Characterization of the novel antifungal protein PgAFP and the encoding gene of Penicillium chrysogenum.##Selection of antifungal protein-producing molds from dry-cured meat products.
DRAMP02448	ASGGTVGXYGAWMRSXSLVSXSTITTFS	28	Antibacterial protein LC3 (Antibacterial protein LCIII)	Q9R5C6	Not found	Not found	Bacillus subtilis	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Has antibacterial activity.
Miscellaneous: On a 2D-GEL the determined pI of this protein is: 9.12."	X. campestris strain G and P. solacearum PO1.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	1295599	Chin J Biotechnol. 1992;8(3):187-193.	"Liu J, Li Z, Pan N, Chen Z."	Purification and partial characterization of an antibacterial protein LCIII.
DRAMP02455	ADSRNPLEEEFRETNYEEF	19	L-amino-acid oxidase (ACL-LAO; LAAO; LAO)	P0CC16	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Agkistrodon contortrix laticinctus (Broad-banded copperhead)(Agkistrodon mokasen laticinctus)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (L-Ile followed by L-Phe, L-Met, L-Val, L-Arg, L-Leu), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage (minimum hemorrhagic dose of 10 ?g), and apoptosis. May also induce hemolysis, edema, antibacterial and antiparasitic activities. May also regulate platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions.
Tissue specificity: Expressed by the venom gland."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	10441379	Arch Biochem Biophys. 1999 Aug 15;368(2):285-290.	"Souza DH, Eugenio LM, Fletcher JE, Jiang MS, Garratt RC, Oliva G, Selistre-de-Araujo HS."	Isolation and structural characterization of a cytotoxic L-amino acid oxidase from Agkistrodon contortrix laticinctus snake venom: preliminary crystallographic data.
DRAMP02458	ADDKNPLEECFREDDYEGFLEIAKNGLSTTSNPKRVVIVGAGMSGLAAY	49	"L-amino-acid oxidase (BiLAO; LAAO; LAO; snakes, reptils, animals)"	P0DI87	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothrops insularis (Golden lancehead) (Queimada jararaca)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity). In addition, this protein induces apoptosis and necrosis and has inhibitory effects on rat kidney Function: (decrease of blood flow and glomerular filtration).
Tissue specificity: Expressed by the venom gland."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	17983639	Toxicon. 2008 Feb;51(2):199-207.	"Braga MD, Martins AM, Amora DN, de Menezes DB, Toyama MH, Toyama DO, Marangoni S, Alves CD, Barbosa PS, de Sousa Alves R, Fonteles MC, Monteiro HS."	Purification and biological effects of L-amino acid oxidase isolated from Bothrops insularis venom.
DRAMP02459	ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV	37	"L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)"	P0DI88	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothrops jararaca (Jararaca)	"Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic, Antitumor"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (L-Met, L-Leu, L-Phe, L-Ile), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, edema, apoptosis of vascular endothelial cells or tumor cell lines, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. This protein induce hemolysis and has antibacterial and antiparasitic activities (against the Gram-positive S.aureus). Tested in vivo, this protein significantly inhibits Ehrlich ascite tumors growth and induces an influx of polymorphonuclear cells, as well as spontaneous liberation of hydrogen peroxide from peritoneal macrophages.
Tissue specificity: Expressed by the venom gland.
Miscellaneous: Has parasiticidal activities against both trypanosomes and leishmania, as a result of enzyme-catalyzed hydrogen peroxide production."	Gram-positive bacterium: S. aureus.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18346051##19101583##20615423	Basic Clin Pharmacol Toxicol. 2008 Jun;102(6):533-542.##Toxicon. 2009 Mar 1;53(3):330-341.##Toxicon. 2010 Nov;56(6):944-955.	"de Vieira Santos MM, Sant'Ana CD, Giglio JR, da Silva RJ, Sampaio SV, Soares AM, Fecchio D.##Ciscotto P, Machado de Avila RA, Coelho EA, Oliveira J, Diniz CG, Farías LM, de Carvalho MA, Maria WS, Sanchez EF, Borges A, Chávez-Olórtegui C.##olindo P, Teixeira-Ferreira AS, DaMatta RA, Alves EW."	"Antitumoural effect of an L-amino acid oxidase isolated from Bothrops jararaca snake venom.##Antigenic, microbicidal and antiparasitic properties of an L-amino acid oxidase isolated from Bothrops jararaca snake venom.##L-amino acid oxidase activity present in fractions of Bothrops jararaca venom is responsible for the Induction: of programmed cell death in Trypanosoma cruzi."
DRAMP02460	ADDRNPLEECFRETDYEEFLEIAKNGLSTT	30	"L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)"	P0DI89	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothrops leucurus (White-tailed jararaca) (White-tailed lancehead)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (high activity against L-Met, L-Leu, L-Nle, L-Trp, L-Phe and moderate activity against L-Tyr), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities (By similarity). In addition, this protein induces apoptosis. It also interacts with endothelial cells, and inhibits collagen- and ADP-induced platelet aggregation. L-LAAO family effects on platelets are controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions.
Tissue specificity: Expressed by the venom gland.
Miscellaneous: Has parasiticidal activities against both trypanosomes and leishmania, as a result of enzyme-catalyzed hydrogen peroxide production.
Biophysicochemical properties: pH dependence (Optimum pH is 7.5-8.8 for L-Leu)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	21539897	Biochim Biophys Acta. 2011 Jul;1810(7):683-694.	"Naumann GB, Silva LF, Silva L, Faria G, Richardson M, Evangelista K, Kohlhoff M, Gontijo CM, Navdaev A, de Rezende FF, Eble JA, Sanchez EF."	Cytotoxicity and inhibition of platelet aggregation caused by an l-amino acid oxidase from Bothrops leucurus venom.
DRAMP02461	AHDGNPLEECFREDDEEFFLEIAKNGLTATSNPKRVVIV	39	"L-amino-acid oxidase (BmarLAAO; LAAO; LAO; snakes, reptils, animals)"	P0CJ40	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothrops marajoensis (Marajo lancehead)	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. In addition, this protein inhibits dose-dependently the growth of Gram-positive, Gram-negative bacteria and yeast, probably by the generation of hydrogen peroxide.
Tissue specificity: Expressed by the venom gland.
Miscellaneous: Has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	19944711	Toxicon. 2010 Apr 1;55(4):795-804.	"Costa Torres AF, Dantas RT, Toyama MH, Diz Filho E, Zara FJ, Rodrigues de Queiroz MG, Pinto Nogueira NA, Rosa de Oliveira M, de Oliveira Toyama D, Monteiro HS, Martins AM."	Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: phospholipase A2 and L-amino acid oxidase.
DRAMP02462	DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKK	95	"L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)"	P0DI91	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Naja oxiana (Central Asian cobra) (Oxus cobra)	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as antibacterial activity against both Gram-positive (B.subtilis) and Gram-negative (E.coli) bacteria, and inhibition of ADP- or collagen-induced platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, edema, apoptosis, and have antiparasitic activities.
Tissue specificity: Expressed by the venom gland.
Biophysicochemical properties: Kinetic parameters (KM=0.885 mM for L-Met; KM=0.051 mM for L-Phe; KM=0.147 mM for L-Trp; KM=0.75 mM for L-Leu)"	Gram-positive bacterium: Bacillus subtilis;##Gram-negative bacterium: E. coli.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18294891	Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):572-580.	"Samel M, T?nism?gi K, R?nnholm G, Vija H, Siigur J, Kalkkinen N, Siigur E."	L-Amino acid oxidase from Naja naja oxiana venom.
DRAMP02464	GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP	60	"L-amino-acid oxidase (LAAO, LAO; reptilia, animals)"	Q6T627	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bitis gabonica (Gaboon adder) (Gaboon viper)	"Antimicrobial, Antibacterial, Antiparasitic"	Transcript level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	15276202	Gene. 2004 Aug 4;337:55-69.	"Francischetti IM, My-Pham V, Harrison J, Garfield MK, Ribeiro JM."	Bitis gabonica (Gaboon viper) snake venom gland: toward a catalog for the full-length transcripts (cDNA) and proteins.
DRAMP02465	ADDINPKEECFFEDDYYEFE	20	"L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)"	P86535	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Daboia russelii (Russel's viper) (Vipera russelii)	"Antimicrobial, Antibacterial, Antitumor, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity.
Tissue specificity: Expressed by the venom gland.
Biophysicochemical properties: Kinetic parameters (KM=0.297 mM for L-Met; KM=1.44 mM for L-Ile; KM=0.750 mM for L-Leu; KM=0.066 mM for L-Phe; KM=0.210 mM for L-Trp; KM=0.052 mM for L-Tyr; Vmax=8.96 ?mol/min/mg enzyme toward L-Phe)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18384385##20203422	FEBS J. 2008 May;275(9):2078-2095.##Biomed Res. 2010 Feb;31(1):71-81.	"Mandal S, Bhattacharyya D.##Suzuki M, Itoh T, Anuruddhe BM, Bandaranayake IK, Shirani Ranasinghe JG, Athauda SB, Moriyama A."	Two L-amino acid oxidase isoenzymes from Russell's viper (Daboia russelli russelli) venom with different mechanisms of inhibition by substrate analogs.##Molecular diversity in venom proteins of the Russell's viper (Daboia russellii russellii) and the Indian cobra (Naja naja) in Sri Lanka.
DRAMP02466	ADDKNPLEECFCEDDDYCEG	20	"L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)"	P0DI90	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Daboia russelii (Russel's viper) (Vipera russelii)	"Antimicrobial, Antibacterial, Antitumor, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity.
Tissue specificity: Expressed by the venom gland.
Biophysicochemical properties: Kinetic parameters (KM=1.89 mM for L-Ile; KM=599.7 ?M for L-Leu; KM=222.8 ?M for L-Met; KM=49.3 ?M for L-Phe; KM=235.1 ?M for L-Trp; KM=538.2 ?M for L-Tyr; Vmax=6.94 ?mol/min/mg enzyme toward L-Phe)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18384385	FEBS J. 2008 May;275(9):2078-2095.	"Mandal S, Bhattacharyya D."	Two L-amino acid oxidase isoenzymes from Russell's viper (Daboia russelli russelli) venom with different mechanisms of inhibition by substrate analogs.
DRAMP02467	ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIK	88	"L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)"	P0C2D7	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Vipera berus berus (Common viper)	"Antimicrobial, Antibacterial, Antitumor, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (the most specific substrate is L-Phe, followed by L-Met, L-Leu, L-Phe, L-Ile, L-Arg and L-His), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities By similarity. In addition, this protein has an ability to induce apoptosis in cultured HeLa and K562 cells, and inhibits ADP-induced platelet aggregation dose-dependently. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions.
Tissue specificity: Expressed by the venom gland. 
Biophysicochemical properties: Kinetic parameters (KM=0.361 mM for L-Leu; KM=0.286 mM for L-Met; KM=0.058 mM for L-Phe)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	16574513	Biochim Biophys Acta. 2006 Apr;1764(4):707-714.	"Samel M, Vija H, R?nnholm G, Siigur J, Kalkkinen N, Siigur E."	Isolation and characterization of an apoptotic and platelet aggregation inhibiting L-amino acid oxidase from Vipera berus berus (common viper) venom.
DRAMP02488	ADDRNPLEEFRENNYEEFL	19	"L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)"	P0DI85	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Deinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus)	"Antimicrobial, Antibacterial, Antitumor, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity). Induces apoptosis in HeLa cervical cancer cells. Both the caspase-dependent and the mitochondrial pathways seem to be involved in apoptosis.
Tissue specificity: Expressed by the venom gland."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	17275856	Life Sci. 2007 Mar 6;80(13):1189-1197.	"Zhang L, Wei LJ."	"ACTX-8, a cytotoxic L-amino acid oxidase isolated from Agkistrodon acutus snake venom, induces apoptosis in Hela cervical cancer cells."
DRAMP02512	ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV	61	"L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)"	P0C2D2	Not found	Not found	Crotalus durissus cascavella (Northeastern Brazilian rattlesnake)	"Antimicrobial, Antibacterial, Antiparasitic, Cytotoxic"	Protein level	Not found	Not found	None	"Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, and edema. Also has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production, and the 50% inhibitory concentration was estimated in 2.39 microg/ml."	"Xanthomonas axonopodis pv passiflorae, Streptococcus mutans, Leishmania amazonensis."	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	16307769	Toxicon. 2006 Jan;47(1):47-57.	"Toyama MH, Toyama Dde O, Passero LF, Laurenti MD, Corbett CE, Tomokane TY, Fonseca FV, Antunes E, Joazeiro PP, Beriam LO, Martins MA, Monteiro HS, Fonteles MC."	Isolation of a new L-amino acid oxidase from Crotalus durissus cascavella venom.
DRAMP02902	ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY	49	"L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)"	P0C2D1	Belongs to the flavin monoamine oxidase family (FIG1 subfamily)	Not found	Bothrops pirajai (Piraja's lance head)	"Antimicrobial, Antibacterial, Anti-Gram-, Antiparasitic"	Protein level	Not found	Not found	None	"FunctionCatalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. This protein may also have activities in hemorrhage, hemolysis, and apoptosis.
Tissue specificity: Expressed by the venom gland.
Miscellaneous: Has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production."	"Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa. Leishmania sp.."	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	16809041	Bioorg Med Chem. 2006 Oct 15;14(20):7034-7043.	"Izidoro LF, Ribeiro MC, Souza GR, Sant'Ana CD, Hamaguchi A, Homsi-Brandeburgo MI, Goulart LR, Beleboni RO, Nomizo A, Sampaio SV, Soares AM, Rodrigues VM."	Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom.
DRAMP03064	HGVSGHGQHGVHG	13	"Alloferon-1 (Insects, animals)"	P83412	Not found	Not found	Calliphora vicina (Blue blowfly) (Calliphora erythrocephala)	"Antimicrobial, Antiparasitic, Antiviral, Antitumor"	Protein level	Not found	Not found	None	"Function: Antimicrobial peptide presumably with antiparasitic, antiviral and/or Antitumoral activities.
Tissue specificity: Hemolymph.
Induction: By bacterial infection.
Miscellaneous: Stimulates antiviral and antitumoral resistance when injected in mice. Enhances natural cytotoxicity of blood and spleen lymphocytes. Induces interferon production in mouse and human."	Human influenza viruses A and B.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	12235362	Proc Natl Acad Sci U S A. 2002 Oct 1;99(20):12628-32.	"Chernysh S, Kim SI, Bekker G, Pleskach VA, Filatova NA, Anikin VB, Platonov VG, Bulet P."	Antiviral and antitumor peptides from insects.
DRAMP03094	DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC	44	"Drosomycin-2 (Insects, animals)"	No entry found	Not found	Not found	Drosophila melanogaster (Fruit fly)	"Antimicrobial, Antifungal, Antiparasitic"	Not found	Not found	Not found	None	"Function: Drosomycin-2 is antiparasitic peptide which shows inhibitory effect on the ookinete development of the parasite Plasmodium berghei.
Induction: Expressed in larva, pupa and adult."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18657321	Mol Immunol. 2008 Sep;45(15):3909-3916.	"Tian C, Gao B, Rodriguez Mdel C, Lanz-Mendoza H, Ma B, Zhu S."	"Gene expression, antiparasitic activity, and functional evolution of the drosomycin family."
DRAMP18210	SCNCVCGVCCSC	12	Amythiamicin C/D(Bacteriocin)	P0C912	Belongs to the class I bacteriocin	Not found	Amycolatopsis sp. (strain MI481-42F4 / FERM P-12739)	"Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic"		Not found	"The main frame from C-1 to C-41 of these antibiotics was the same as that of amythiamicin D. Amino acid autoanalyses of amythiamicins A, B and C showed that these have another one mole of serine and proline in comparison with amythiamicin D. Stereochemistries of both amino acids were determined to be L by chiral HPLC. These seryl-prolyl residues in amythiamicins A, B and C are attached at C-41 through an oxazoline ring, amide and ester "	None	"Sequence uncertainty (position 4): C or T. Function: Has bacteriocidal activity against Gram-positive bacteria: including multi-drug resistant strains such as Staphylococcus aureus MS9610 and Methicillin-resistant S.aureus, but is not active against most Gram-negative bacteria and fungi."	Gram-positive	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Elongation Factor Tu  (EF-Tu)	8040071##7961166##16262432	J Antibiot (Tokyo). 1994 Jun;47(6):668-74.##J Antibiot (Tokyo). 1994 Oct;47(10):1153-9.##J Am Chem Soc. 2005 Nov 9;127(44):15644-51.	"Shimanaka K, Kinoshita N, Iinuma H, Hamada M, Takeuchi T.##Shimanaka K, Takahashi Y, Iinuma H, Naganawa H, Takeuchi T.##Hughes RA, Thompson SP, Alcaraz L, Moody CJ."	"Novel antibiotics, amythiamicins. I. Taxonomy, fermentation, isolation, physico-chemical properties, and antimicrobial activity.##Novel antibiotics, amythiamicins. III. Structure elucidations of amythiamicins A, B and C.##Total synthesis of the thiopeptide antibiotic amythiamicin D."
DRAMP03469	MDVVRTLILCVCLFGLTFA	19	"Serine protease inhibitor Cvsi-1 (molluscs, animals)"	"Q30HU9, P84574"	Not found	Not found	Crassostrea virginica (Eastern oyster)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Slow-binding inhibitor of serine proteases. The inhibitor rapidly binds to the protease forming a weak enzyme-inhibitor complex, and this is followed by a slow isomerization forming a tight-binding enzyme-inhibitor complex. Active against subtilisin A, perkinsin and trypsin with dissociation constants of 0.29 nM, 13.7 nM and 17.7 nM respectively. Not active against thermolysin, papain or pepsin. Has antiparasitic activity against the protozoan P. marinus.
Tissue specificity: Detected in hemolymph (at protein level). In oysters collected in the summer the expression level is highest in the digestive gland with low levels of expression in gill, mantle, labial palp, style-sac midgut, gonad, heart, and hemocyte. In winter expression levels are higher in all tissues with highest expression levels observed in the digestive gland. Within the digestive gland expression is limited to the basophil cells of the digestive diverticula."	Subtilisin A and Prochlorococcus marinus.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	16872855##19720077	Comp Biochem Physiol B Biochem Mol Biol. 2006 Sep;145(1):16-26.##Dev Comp Immunol. 2010 Jan;34(1):84-92.	"Xue QG, Waldrop GL, Schey KL, Itoh N, Ogawa M, Cooper RK, Losso JN, La Peyre JF.##La Peyre JF, Xue QG, Itoh N, Li Y, Cooper RK."	"A novel slow-tight binding serine protease inhibitor from eastern oyster (Crassostrea virginica) plasma inhibits perkinsin, the major extracellular protease of the oyster protozoan parasite Perkinsus marinus.##Serine protease inhibitor cvSI-1 potential role in the eastern oyster host defense against the protozoan parasite Perkinsus marinus."
DRAMP03557	GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL	83	"Granulysin (Lymphokine LAG-2; Human, mammals, animals)"	P22749	Not found	GNLY	Homo sapiens (Human)	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Protein level	Alpha helix	Not found	1L9L resolved by X-ray.	"Function: Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
Tissue specificity: Expressed in natural killer and T-cells.
Induction: By T-cell growth factor and IL2/interleukin-2."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	9756476##12488100	Science. 1998 Oct 2;282(5386):121-125.##J Mol Biol. 2003 Jan 10;325(2):355-365.	"Stenger S, Hanson DA, Teitelbaum R, Dewan P, Niazi KR, Froelich CJ, Ganz T, Thoma-Uszynski S, Melián A, Bogdan C, Porcelli SA, Bloom BR, Krensky AM, Modlin RL.##Anderson DH, Sawaya MR, Cascio D, Ernst W, Modlin R, Krensky A, Eisenberg D."	An antimicrobial activity of cytolytic T cells mediated by granulysin.##Granulysin crystal structure and a structure-derived lytic mechanism.
DRAMP03558	EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES	70	"human platelet factor 4 (hPF4; Human, mammals, animals)"	No entry found	Belongs to the intercrine alpha (chemokine CxC) family	Not found	Homo sapiens (Human)	Antiparasitic	Not found	Not found	Not found	None	Function: human platelet factor 4 (hPF4) kills malaria parasites inside erythrocytes by selectively lysing the parasite digestive vacuole (DV). 	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	23245326	Cell Host Microbe. 2012 Dec 13;12(6):815-823.	"Love MS, Millholland MG, Mishra S, Kulkarni S, Freeman KB, Pan W, Kavash RW, Costanzo MJ, Jo H, Daly TM, Williams DR, Kowalska MA, Bergman LW, Poncz M, DeGrado WF, Sinnis P, Scott RW, Greenbaum DC."	Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials.
DRAMP03559	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP	77	"CXCL10 (Human, mammals, animals)"	"P02778, Q96QJ5"	Belongs to the intercrine alpha (chemokine CxC) family	CXCL10	Homo sapiens (Human)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Combine helix and beta structure	Not found	"1O80,1O7Z,1O7Y resolved by X-ray.##1LV9 resolved by NMR."	Function: Chemotactic for monocytes and T-lymphocytes.	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Binds to CXCR3	12949249##12737818	J Leukoc Biol. 2003 Sep;74(3):448-455.##Structure. 2003 May;11(5):521-32.	"Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.##Swaminathan GJ, Holloway DE, Colvin RA, Campanella GK, Papageorgiou AC, Luster AD, Acharya KR."	Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.##Crystal structures of oligomeric forms of the IP-10/CXCL10 chemokine.
DRAMP03560	TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN	69	"CXC chemokine GRObeta [5-73] (Human, mammals, animals)"	P19875	Belongs to the intercrine alpha (chemokine CxC) family	CXCL2	Homo sapiens (Human)	"Antimicrobial, Antibacterial, Antiparasitic, Chemotactic"	Protein level	Combine helix and beta structure	"GRObeta [5-73] forms a dimer in solution that is architectured by a six-stranded antiparallel beta-sheet (residues 25 to 29, 39 to 44, 49 to 52) and a pair of helices (residues 58 to 68) with 2-fold symmetry, while the C terminus of the protein is disordered.(Ref.2)"	1QNK resolved by NMR.	"Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
PTM: The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.
Pharmaceutical use: GRO-beta(5-73) is available under the name Garnocestim as immunomodulator. It is used prior to hematopoietic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy induced cytopenias."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	12949249##10600366	J Leukoc Biol. 2003 Sep;74(3):448-455.##J Mol Biol. 1999 Dec 17;294(5):1065-1072.	"Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.##Qian YQ, Johanson KO, McDevitt P."	Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.##Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.
DRAMP03561	GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN	77	"CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals)"	P80162	Belongs to the intercrine alpha (chemokine CxC) family	CXCL6	Homo sapiens (Human)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	Function: Chemotactic for neutrophil granulocytes.	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Heparin-binding	18443119	Antimicrob Agents Chemother. 2008 Jul;52(7):2599-2607.	"Linge HM, Collin M, Nordenfelt P, M?rgelin M, Malmsten M, Egesten A."	The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial.
DRAMP18202	LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP	46	"WB Piscidin 5 (fish, animals)"	E3UVF7(Precursor)	Belongs to the defensin family	Not found	Morone chrysops	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic"		Not found	Not found	None	No more comments	Staphylococcus aureus ATCC 29213(MIC 4.52uM)	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Lipid-binding	27552222	PLoS One. 11(8):e0159423(2016)	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.
DRAMP18200	FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP	55	"SB Piscidin 6 (fish, animals)"	No entry found	Belongs to the defensin family	Not found	Morone saxatilis	"Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic"		Not found	Not found	None	No more comments	Staphylococcus aureus ATCC 29213(MIC >32.11uM)	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Lipid-binding	27552222	PLoS One. 11(8):e0159423(2016)	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.
DRAMP18201	LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP	55	"WB Piscidin 6 (fish, animals)"	No entry found	Belongs to the defensin family	Not found	Morone chrysops	"Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic"		Not found	Not found	None	No more comments	Staphylococcus aureus ATCC 29213(MIC >31.59uM)	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Lipid-binding	27552222	PLoS One. 11(8):e0159423(2016)	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.
DRAMP03611	KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ	48	"Beta-defensin 110 (Beta-defensin 10, DEFB-10; Defensin, beta 110; Human, mammals, animals)"	"Q30KQ9, Q30KR0"	Belongs to the beta-defensin family	DEFB110	Homo sapiens (Human)	"Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic"	Transcript level	Bridge 	Not found	None	"Function: Has antibacterial activity.
PTM: Contains three disulfide bonds (By similarity)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	16033865	Physiol Genomics. 2005 Sep 21;23(1):5-17.	"Patil AA, Cai Y, Sang Y, Blecha F, Zhang G."	Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
DRAMP04673	PAAAAQAVAGLAPVAAEQ	18	Alamethicin (ALM; fungi)	No entry found	Not found	Not found	Trichoderma viride	"Antimicrobial, Antibacterial, Antifungal, Antiparasitic"	Not found	Alpha helix	The molecular conformation of the three crystallographically independent molecules is largely alpha-helical with a bend in the helix axis at an internal proline residue. The helix structure is highly amphipathic as most of the solvent-accessible polar atoms lie on a narrow strip of surface parallel to the helix axis.(Ref.2)	1AMT resolved by X-ray.	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	PubMed ID is not available##6292726	"Experientia, 1967; 23: 85-86.##Nature. 1982 Nov 25;300(5890):325-330."	"Meyer CE, Reusser F.##Fox RO Jr, Richards FM."	Polypeptide anti-bacterial agent isolated from Trichoderma viride.##A voltage-gated ion channel model inferred from the crystal structure of alamethicin at 1.5-A resolution.
DRAMP04700	DLWQFGKMILKVAGKLPFPYYGAYGCYCGWGGRGKPKDPTDRCCFVHDCC	50	"Basic phospholipase A2 BnpTX-1 (BnPTx-I, svPLA2; Phosphatidylcholine 2-acylhydrolase)"	P0DM51	Belongs to the phospholipase A2 family (Group II subfamily D49 sub-subfami	Not found	Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedipauloensis)	"Antimicrobial, Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-"	Protein level	Not found	Not found	None	"Function: Snake venom phospholipase A2 (PLA2). In vitro, shows anticoagulant activity and induces cytotoxicity when tested on C2C12 myoblasts/myotubes. In vivo, when tested on mice, induces myotoxicity (intramuscular injection), edema (injection in the subplantar region) and lethality. Also induces neurotoxic effect on mouse neuromuscular preparations and has bactericidal activity on the Gram-negative bacteria E.coli (ATCC29648) and the Gram- positive S.aureus (ATCC 25923). The catalytic and anticoagulant activities of BnpTX-I are higher than those of BnpTX-II. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Toxic Dose: LD(50) is 5.1 +/- 1.3 mg/kg by intraperitoneal injection into mice. LD(50) is 2.3 +/- 0.8 mg/kg by intravenous injection into mice.
Miscellaneous: Has a pI of approximately 7.8 and about 121 amino acids (PubMed:15302537).
PTM: Contains seven disulfide bonds."	Gram-negative bacterium: E. coli ATCC29648 and Gram-positive bacterium: S. aureus ATCC 25923.	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	15302537	Toxicon. 2004 Sep 1;44(3):305-314.	"Rodrigues VM, Marcussi S, Cambraia RS, de Araújo AL, Malta-Neto NR, Hamaguchi A, Ferro EA, Homsi-Brandeburgo MI, Giglio JR, Soares AM."	Bactericidal and neurotoxic activities of two myotoxic phospholipases A2 from Bothrops neuwiedi pauloensis snake venom.
DRAMP04701	SLLELGKMILQETGKMPSKSYGAYGCNCGVLGR	33	"Phospholipase A2 homolog (BmarPLA2, svPLA2 homolog)"	P0DI92	Belongs to the phospholipase A2 family (Group II subfamily)	Not found	Bothrops marajoensis (Marajo lancehead)	"Antimicrobial, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Snake phospholipase A2 homolog that lacks enzymatic activity. May display myotoxin activity. Does not show antimicrobial activity.
PTM: Contains seven disulfide bonds (By similarity)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	19944711	Toxicon. 2010 Apr 1;55(4):795-804.	"Costa Torres AF, Dantas RT, Toyama MH, Diz Filho E, Zara FJ, Rodrigues de Queiroz MG, Pinto Nogueira NA, Rosa de Oliveira M, de Oliveira Toyama D, Monteiro HS, Martins AM."	Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: Phospholipase A2 and L-amino acid oxidase.
DRAMP18132	ADPRNPLEECFRETD	15	L-amino-acid oxidase Bfon20 (LAAO; LAO)	P0DMG9	Belongs to the flavin monoamine oxidase family	Not found	Bothrops fonsecai (Fonseca's lancehead) (Rhinocerophis fonsecai)	"Antimicrobial, Antitumor, Antibacterial, Antiparasitic"	Protein level	Not found	Not found	None	"Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity)."	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	18760386	J. Proteomics 71:473-485 (2008).	"Tashima A.K., Sanz L., Camargo A.C. , Serrano S. M. , Calvete J.J."	Snake venomics of the Brazilian pitvipers Bothrops cotiara andBothrops fonsecai. Identification of taxonomy markerS. 
DRAMP18421	GFGCPKSALSCSQQCRENNTHSGGYCNGPFNIVCSCY	37	"DefMT7 (defensin MT7; hard ticks, arachnids, arthropods, invertebrates, animals)"	No entry found	Belongs to the defensin family.	Not found	Ixodes ricinus	"Antiparasitic, Antimalarial"		Bridge	Not found	None	Fuction: The peptide showed no activity against bacteria. It showed antimalarial activity. 	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27822206##26255244	Front Microbiol. 2016 Oct 24;7:1682. ##Dev Comp Immunol. 2015 Dec;53(2):358-65.	"Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald"	Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.##Ixodes ricinus defensins attack distantly-related pathogens.
DRAMP18422	GYFCPYNGYCDHHCRKKLRWRGGYCGGRWKLTCICVRG	38	"DefMT2 (defensin MT2;hard ticks, arachnids, arthropods, invertebrates, animals)"	No entry found	Belongs to the defensin family.	Not found	Ixodes ricinus	"Antiparasitic, Antimalarial"		Bridge	Not found	None	Fuction: The peptide showed no activity against bacteria. It showed antimalarial activity. 	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27822206##26255244	Front Microbiol. 2016 Oct 24;7:1682. ##Dev Comp Immunol. 2015 Dec;53(2):358-65.	"Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald"	Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.##Ixodes ricinus defensins attack distantly-related pathogens.
DRAMP18426	GVIDIIKGAGKDLIAHAIGKLAEKV	25	"Ocellatin-PT3 (frog, amphibians, animals)"	No entry found	Not found	Not found	"Skin Secretion, dorsal, Leptodactylus pustulatus"	Antiparasitic		Helix	Not found	None	Fuction: It has leishmanicidal activity.	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	26107622##27463422	J Nat Prod. 2015 Jul 24;78(7):1495-504. ##Biopolymers. 2016 Dec;105(12):873-86.	"Marani MM, Dourado FS, Quelemes PV, de Araujo AR, Perfeito ML, Barbosa EA, V"	Characterization and Biological Activities of Ocellatin Peptides from the Skin Secretion of the Frog Leptodactylus pustulatus.  ##Ocellatin-PT antimicrobial peptides: High-resolution microscopy studies in antileishmania models and interactions with mimetic membrane systems.
DRAMP18438	FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP	55	"SB Piscidin 6 (fish, animals)"	No entry found	Not found	Not found	Morone saxatilis	"Antimicrobial, Antibacterial, Antiparasitic"		Not found	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27552222	PLoS One. 2016 Aug 23;11(8):e0159423.	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes
DRAMP18439	LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP	55	"WB Piscidin 6 (fish, animals)"	No entry found	Not found	Not found	Morone chrysops	"Antimicrobial, Antibacterial, Antiparasitic"		Not found	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27552222	PLoS One. 2016 Aug 23;11(8):e0159423.	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes
DRAMP18440	LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP	46	"WB Piscidin 5 (fish, animals)"	No entry found	Not found	Not found	Morone chrysops	"Antimicrobial, Antibacterial, Antiparasitic"		Not found	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27552222	PLoS One. 2016 Aug 23;11(8):e0159423.	"Salger SA, Cassady KR, Reading BJ, Noga EJ"	A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes
DRAMP18419	GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG	55	STiDA-2	No entry found	Belongs to the defensin family.	Not found	Deduced; synthetic	Antiparasitic		Bridge	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27822206	Front Microbiol. 2016 Oct 24;7:1682	"Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald"	Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.
DRAMP18420	GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKTRPPFILG	55	STiDA-1 	No entry found	Belongs to the defensin family.	Not found	Deduced; synthetic	"Antiparasitic, Antimalarial"		Bridge	Not found	None	Comment: No comments found on DRAMP database	No MICs found in DRAMP database	No hemolysis information or data found in the reference(s) presented in this entry	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not included yet	Not found	27822206	Front Microbiol. 2016 Oct 24;7:1682	"Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald"	Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.
DRAMP20933	FFSLIPSLVGGLISAFK	17	Stigmurin	No entry found	Derived from scorpion venom peptide	Not found	Tityus stigmurus	"Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiparasitic, Antiproliferative"	Transcript level	Alpha helix 	Not found	None	Function: Antibacterial activity against the Gram-positive bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells.	"[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=9.38 μM), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 μM);##yeasts: Candida albicans ATCC 90028 (MIC=37.5 μM);##Stigmurin inhibit 90% of the epimastigote forms of Trypanosoma cruzi growth at 25 ?M;##HeLa cell line: IC50=7.98 μM"	"[Ref.29670004]Hemolysis 0% at 1.17 μM, hemolysis 1% at 2.34 μM, hemolysis 1% at 4.69 μM, hemolysis 0% at 9.38 μM, hemolysis 1% at 18.75 μM, hemolysis 1% at 37.50 μM, hemolysis 3% at 75.00 μM against human red blood cell"	Linear	Free	Amidation	None	L	"[Ref.29670004] The cell viability of HeLa cell lines is 56%, 66%, 66%, 81%, 78%, 66% and 30% at peptide concentrations of 2, 4, 8, 10, 15,  20 and 40 μM. ##The cell viability of 3T3 cell lines is 81%, 63%, 51%, 29%, 27%, 19% and 15% at peptide concentra"	Not found	29670004	Toxins (Basel). 2018 Apr 18;10(4). pii: E161.	"Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Júnior AA, Silva MS, Fernandes-Pedrosa MF."	"Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity."
DRAMP20957	FFSLIPKLVKGLISAFK	17	StigA6	No entry found	Derived from scorpion venom peptide	Not found	Synthetic construct	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antiproliferative"	Synthetic	Alpha helix 	"The peptide adopts helical conformation with some random structure at the N- and C-terminals. In sodium phosphate buffer (PBS) and water they have a predominantly random structure, but in 20 mM sodium dodecyl sulfate (SDS) and 2,2,2-trifluoroethanol (TFE) they have a typical alpha-helix structure."	None	Function: Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells.	"[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=2.34 μM), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 μM), Enterococcus faecalis ATCC 4028 (MIC=1.17 μM);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=4.69 μM), Enterobacter cloacae ATCC 13047 (MIC=18.75 μM), Pseudomonas aeruginosa ATCC 27853 (MIC=9.38 μM);##yeasts: Candida albicans ATCC 90028 (MIC=9.38 μM), Candida krusei ATCC 6258 (MIC=37.5 μM), Candida glabrata ATCC 90030 (MIC=18.75 μM);##StigA6 inhibit 100% of the epimastigote forms of Trypanosoma cruzi growth at 2.5 ?M;##HeLa cell line: IC50=14.01 ?M"	"[Ref.29670004] Hemolysis 0% at 1.17 μM, hemolysis 2% at 2.34 μM, hemolysis 15% at 4.69 μM, hemolysis 27% at 9.38 μM, hemolysis 30% at 18.75 μM, hemolysis 30% at 37.50 μM, hemolysis 27% at 75.00 μM against human red blood cells"	Linear	Free	Amidation	None	L	"[Ref.29670004] The cell viability of HeLa cell lines is 19%, 15%, 11%, 29%, 9%, 13% and 8% at peptide concentrations of 2, 4, 8, 10, 15, 20 and 40 μM.  ##The cell viability of 3T3 cell lines is 81%, 73%, 69%, 61%, 51%, 20% and 15% at peptide concentrati"	Not found	29670004	Toxins (Basel). 2018 Apr 18;10(4). pii: E161.	"Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Júnior AA, Silva MS, Fernandes-Pedrosa MF."	"Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity."
DRAMP20958	FFKLIPKLVKGLISAFK	17	StigA16	No entry found	Derived from scorpion venom peptide	Not found	Synthetic construct	"Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antiproliferative"	Synthetic	Alpha helix 	"The peptide adopts helical conformation with some random structure at the N- and C-terminals. In sodium phosphate buffer (PBS) and water they have a predominantly random structure, but in 20 mM sodium dodecyl sulfate (SDS) and 2,2,2-trifluoroethanol (TFE) they have a typical alpha-helix structure."	None	Function: Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells.	"[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=2.34 μM), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 μM), Enterococcus faecalis ATCC 4028 (MIC=1.17 μM);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=2.34 μM), Enterobacter cloacae ATCC 13047 (MIC=9.38 μM), Pseudomonas aeruginosa ATCC 27853 (MIC=1.17 μM);##yeasts: Candida albicans ATCC 90028 (MIC=4.69 μM), Candida krusei ATCC 6258 (MIC=9.38 μM), Candida glabrata ATCC 90030 (MIC=9.38 μM);##StigA16 inhibit 100% of the epimastigote forms of Trypanosoma cruzi growth at 2.5 ?M;##HeLa cell line: IC50=13.01 ?M"	"[Ref.29670004] Hemolysis 0% at 1.17 [Ref.29670004] Hemolysis 0% at 1.17 μM, hemolysis 2% at 2.34 μM, hemolysis 10% at 4.69 μM, hemolysis 20% at 9.38 μM, hemolysis 35% at 18.75 μM, hemolysis 37% at 37.50 μM, hemolysis 40% at 75.00 μM against human red blood cells"	Linear	Free	Amidation	None	L	"[Ref.29670004] The cell viability of HeLa cell lines is 15%, 21%, 16%, 9%, 8%, 10% and 11% at peptide concentrations of 2, 4, 8, 10, 15, 20 and 40 μM. ##The cell viability of 3T3 cell lines is 69%, 77%, 62%, 47%, 21%, 15% and 15% at peptide concentratio"	Not found	29670004	Toxins (Basel). 2018 Apr 18;10(4). pii: E161.	"Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Júnior AA, Silva MS, Fernandes-Pedrosa MF."	"Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity."