DRAMP_ID Sequence Sequence_Length Name Swiss_Prot_Entry Family Gene Source Activity Protein_existence Structure Structure_Description PDB_ID Comments Target_Organism Hemolytic_activity Linear/Cyclic/Branched N-terminal_Modification C-terminal_Modification Other_Modifications Stereochemistry Cytotoxicity Binding_Traget Pubmed_ID Reference Author Title DRAMP01746 FVQWFSKFLGRIL 13 "Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)" P57104 Belongs to the frog skin active peptide (FSAP) family. Brevinin subfamily. Not found Rana temporaria (European common frog) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anti-cancer" Protein level Alpha helix Not found 6GS5 resolved by NMR. "Function: Antibacterial activity against Gram-negative and Gram-positive bacteria. PTM: Leucine amide at position 13. Tissue specificity: Expressed by the skin glands." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 9022710 Eur J Biochem. 1996 Dec 15;242(3):788-792. "Simmaco M, Mignogna G, Canofeni S, Miele R, Mangoni ML, Barra D." "Temporins, antimicrobial peptides from the European red frog Rana temporaria." DRAMP02478 IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFP 31 "L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)" B3EWI9 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity). Tissue specificity: Expressed by the venom gland." "Gram-positive bacteria: Bacillus subtilis strain ATCC 6633 (MIC=32 ?M), Enterococcus faecalis strain ATCC 12953 (MIC=32 ?M), Staphylococcus aureus strain ATCC 29213 (MIC=32 ?M), Streptococcus pyogenes strain ATCC 19615 (MIC=8 ?M);##Gram-negative bacteria: Escherichia coli strain ATCC 8739 (MIC=4 ?M), Klebsiella pneumoniaee strain ATCC 13885 (MIC=2 ?M), Proteus mirabilis strain ATCC 25933 (MIC=2 ?M), Pseudomonas aeruginosa strain ATCC 15442 (MIC=8 ?M), Salmonella typhimurium strain ATCC 14028 (MIC=8 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 22438972 PLoS One. 2012;7(3):e33639. "Okubo BM, Silva ON, Migliolo L, Gomes DG, Porto WF, Batista CL, Ramos CS, Holanda HH, Dias SC, Franco OL, Moreno SE." Evaluation of an antimicrobial L-amino acid oxidase and peptide derivatives from Bothropoides mattogrosensis pitviper venom. DRAMP18495 QCRRLCYKQRCVTYCRGR 18 "Gomesin (Gm; Spiders, arachnids, Chelicerata, arthropods, invertebrates, animals)" P82358 Belongs to the tachyplesin family Not found Acanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antimalarial, Antic" Protein level Beta sheet Not found 1KFP resolved by NMR. "Function: Antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and fungi. It shows hemolytic activity. Tissue specificity: In hemocytes only, but not in all hemocytes observed." "[Ref.10942757] Gram-positive bacteria: Aerococcus viridans (MIC=0.8-1.6 M), Bacillus cereus (MIC=6.25-12.5 M), Bacillus megaterium (MIC=0.2-0.4 M), Bacillus thuringiensis (MIC=1.6-3.15 M), Enterococcus faecalis (MIC=6.2-12.5 M), Listeria monocytogenes (MIC=0.8-1.6 M), Micrococcus luteus (MIC=0.4-0.8 M), Pediococcus acidolacrici (MIC=3.15-6.25 M), Staphylococcus aureus (MIC=1.6-3.15 M), Staphylococcus epidermidis (MIC=0.8-1.6 M), Staphylococcus haemolyticus (MIC=0.8-1.6 M), Staphylococcus saprophyticus (MIC=0.8-1.6 M), Streptococcus pyogenes (MIC=1.6-3.15 M), Nocardia asteroides (MIC=1.6-3.15 M);##Gram-negative bacteria: Escherichia coli 1106 (MIC=0.8-1.6 M), Escherichia coli D22 (MIC=0.4-0.8 M), Escherichia coli D31 (MIC=0.8-1.6 M), Escherichia coli SBS363 (MIC=0.4-0.8 M), Erwinia carolovora (MIC=3.15-6.25 M), Enterobacter cloacae 12 (MIC=3.15-6.25 M), Klebsiella pneumoniae (MIC=3.15-6.25 M), Pseudomonas aeruginosa (MIC=1.6-3.15 M), Salmonella thyphinurium (MIC=0.8-1.6 M), Xhantomonas campestris pv. orizae (MIC=3.15-6.25 M);##Fungi: Alternaria brassicola (MIC=0.4-0.8 M), Aspergillus fumigatus (MIC=1.6-3.15 M), Beauveria bassiana (MIC=12.5-25 M), Fusarium culmorum (MIC=0.4-0.8 M), Fusarium oxysporum (MIC=0.4-0.8 M), Neurospora crassa (MIC=0.4-0.8 M), Nectria haematococca (MIC=0.2-0.4 M), Tricoderma viridae (MIC=0.4-0.8 M), Tricophvton mentagrophytes (MIC=0.8-1.6 M);##Yeasts: Candida albicans (MIC=0.15-0.3 M), Candida glabrata (MIC=12.5-25 M), Candida tropicalis (MIC=3.15-6.25 M), Cryptococcus neoformans (MIC=0.8-1.6 M), Saccharomyces cerevisiae (MIC=1.6-3.15 M)." [Ref.10942757] It exhibits 16% hemolysis at 1 M and 100 M against human erythrocytes Cyclic pyroglutamic acid Amidation "Disulfide bond between Cys2 and Cys15,Cys6 and Cys11." L No cytotoxicity information found Not found 10942757 J Biol Chem. 2000 Oct 27;275(43):33464-70. "Silva PI Jr, Daffre S, Bulet P." "Isolation and characterization of gomesin, an 18-residue cysteine-rich defense peptide from the spider Acanthoscurria gomesiana hemocytes with sequence similarities to horseshoe crab antimicrobial peptides of the tachyplesin family." DRAMP03150 MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL 61 "Gambicin (Insects, animals)" No entry found Not found Not found Anopheles albimanus (mosquito) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic" Not found Bridge Not found None "Function: In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes. Induction: Predominantly expressed in the anterior part. PTM: Contains four disulfide bridges." Gram-negative bacterium: E. coli (MIC=6.25-12.5 ?M);##Gram-positive bacterium: M. luteus (MIC=25-50 ?M).##Fungus: N. crassa. No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Free "Disulfide bonds between Cys9 and Cys20; Cys12 and Cys32; Cys41 and Cys51,Cys44 and Cys59." L No cytotoxicity information found Not found 11606751 Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5. "Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Mller HM, Dimopoulos G." Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae. DRAMP03162 ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRR 40 "Phlebotomus duboscqi defensin (PduDef; defensins; Insects, animals)" P83404 Belongs to the invertebrate defensin family (Type 1 subfamily) Not found Phlebotomus duboscqi "Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiparasitic" Protein level Bridge Not found None "Function: Has antiparasitic and antifungal activity. Tissue specificity: Is synthesized by the fat body and eventually secreted into the hemolymph. Induction: By bacterial and parasitic hemolymph and gut infections. Expression peaks at 24 hours post infection by bacterium P. carotovorum, and at day four post infection by the parasite L. major. PTM: Problely contains three disulfide bonds 3-30; 16-36; 20-36." "Gram-positive bacteria: Staphylococcus aureus (MIC=0.78-1.56 ?M), Aspergillus fumigatus (MIC=12.5-25 ?M).##Fungi: Fusarium culmorum (MIC=1.56-3.12 ?M), Fusarium oxysporum (MIC=3.12-6.25 ?M), Neurospora crassa (MIC=6.25-12.5 ?M), Trichoderma viride (MIC=3.12-6.25 ?M), Trichophyton mentagrophytes (MIC=25-50 ?M), Candida albicans (MIC=6.25-12.5 ?M), Saccharomyces cerevisiae (MIC=25-50 ?M).##Parasite: Leishmania major promastigote forms (IC50=68-85 ?M)." No hemolysis information or data found in the reference(s) presented in this entry Cyclic Free Free Disulfide bonds between Cys3 and Cys30; Cys16 and Cys36; Cys20 and Cys36. L No cytotoxicity information found Not found 15557638 Infect Immun. 2004 Dec;72(12):7140-7146. "Boulanger N, Lowenberger C, Volf P, Ursic R, Sigutova L, Sabatier L, Svobodova M, Beverley SM, Sp?th G, Brun R, Pesson B, Bulet P." Characterization of a defensin from the sand fly Phlebotomus duboscqi induced by challenge with bacteria or the protozoan parasite Leishmania major. DRAMP00252 VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR 51 AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin) No entry found Not found Not found Anaeromyxobacter dehalogenans (Gram-negative bacteria) "Antibacterial, Antifungal, Antiparasitic, Antimicrobial" Not found Not found "Circular dichroism (CD) analysis indicates that recombinant AdDLP adopts a typical structural feature of eukaryotic defensins, which is also consistent with an ab initio structure model predicted using I-TASSER algorithm." None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 19615342 Biochem Biophys Res Commun. 2009 Sep 18;387(2):393-398. "Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S." "AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity." DRAMP01743 FLPLIGKVLSGIL 13 "Temporin-F (Frogs, amphibians, animals)" P56921 Belongs to the frog skin active peptide (FSAP) family. Brevinin subfamily. Not found Rana temporaria (European common frog) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic" Protein level Not found Not found None "Function: Antibacterial activity against Gram-negative and Gram-positive bacteria. PTM: Leucine amide at position 13. Tissue specificity: Expressed by the skin glands." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 9022710 Eur J Biochem. 1996 Dec 15;242(3):788-792. "Simmaco M, Mignogna G, Canofeni S, Miele R, Mangoni ML, Barra D." "Temporins, antimicrobial peptides from the European red frog Rana temporaria." DRAMP02310 AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH 33 "HbbetaP-1 (fish, chordates, animals)" No entry found Not found Not found Ictalurus punctatus (Catfish) "Antimicrobial, Antibacterial, Antiparasitic" Not found Not found Not found None "Function: Showes moderate activity against Gram-negative bacteria, Aeromonas hydrophila and Vibrio alginolyticus, but no activity against Gram-positive bacteria such as S. aureus, Streptococcus faecalis S. iniae." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18538841 Dev Comp Immunol. 2008;32(11):1301-1312. "Ullal AJ, Litaker RW, Noga EJ." "Antimicrobial peptides derived from hemoglobin are expressed in epithelium of channel catfish (Ictalurus punctatus, Rafinesque)." DRAMP02418 GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK 38 "Longicin (Ticks, Arthropods, animals)" No entry found Not found Not found Haemaphysalis longicornis (Tick) "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Not found Not found Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 17485458 Infect Immun. 2007 Jul;75(7):3633-3640. "Tsuji N, Battsetseg B, Boldbaatar D, Miyoshi T, Xuan X, Oliver JH Jr, Fujisaki K." Babesial vector tick defensin against Babesia sp. parasites. DRAMP02435 LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV 58 Antifungal protein (PgAFP; Cys-rich) "D0EXD3, B6GXZ8" Not found afp Penicillium chrysogenum (Penicillium notatum) "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Protein level Not found Not found None "Function: Has strong antifungal activity against the molds Polytrichum commune Pc332, Penicillium echinulatum Pe321, and Aspergillus niger An261. PTM: Contains three disulfide bonds (By similarity)." "Fungi: Polytrichum commune Pc332, Penicillium echinulatum Pe321, Aspergillus niger An261." No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 19914321##19683356 Peptides. 2010 Apr;31(4):541-547.##Int J Food Microbiol. 2009 Sep 30;135(1):39-46. "Rodrguez-Martn A, Acosta R, Liddell S, N?ez F, Benito MJ, Asensio MA.##Acosta R, Rodrguez-Martn A, Martn A, N?ez F, Asensio MA." Characterization of the novel antifungal protein PgAFP and the encoding gene of Penicillium chrysogenum.##Selection of antifungal protein-producing molds from dry-cured meat products. DRAMP02448 ASGGTVGXYGAWMRSXSLVSXSTITTFS 28 Antibacterial protein LC3 (Antibacterial protein LCIII) Q9R5C6 Not found Not found Bacillus subtilis "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Protein level Not found Not found None "Function: Has antibacterial activity. Miscellaneous: On a 2D-GEL the determined pI of this protein is: 9.12." X. campestris strain G and P. solacearum PO1. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 1295599 Chin J Biotechnol. 1992;8(3):187-193. "Liu J, Li Z, Pan N, Chen Z." Purification and partial characterization of an antibacterial protein LCIII. DRAMP02455 ADSRNPLEEEFRETNYEEF 19 L-amino-acid oxidase (ACL-LAO; LAAO; LAO) P0CC16 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Agkistrodon contortrix laticinctus (Broad-banded copperhead)(Agkistrodon mokasen laticinctus) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (L-Ile followed by L-Phe, L-Met, L-Val, L-Arg, L-Leu), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage (minimum hemorrhagic dose of 10 ?g), and apoptosis. May also induce hemolysis, edema, antibacterial and antiparasitic activities. May also regulate platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. Tissue specificity: Expressed by the venom gland." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 10441379 Arch Biochem Biophys. 1999 Aug 15;368(2):285-290. "Souza DH, Eugenio LM, Fletcher JE, Jiang MS, Garratt RC, Oliva G, Selistre-de-Araujo HS." Isolation and structural characterization of a cytotoxic L-amino acid oxidase from Agkistrodon contortrix laticinctus snake venom: preliminary crystallographic data. DRAMP02458 ADDKNPLEECFREDDYEGFLEIAKNGLSTTSNPKRVVIVGAGMSGLAAY 49 "L-amino-acid oxidase (BiLAO; LAAO; LAO; snakes, reptils, animals)" P0DI87 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothrops insularis (Golden lancehead) (Queimada jararaca) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity). In addition, this protein induces apoptosis and necrosis and has inhibitory effects on rat kidney Function: (decrease of blood flow and glomerular filtration). Tissue specificity: Expressed by the venom gland." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 17983639 Toxicon. 2008 Feb;51(2):199-207. "Braga MD, Martins AM, Amora DN, de Menezes DB, Toyama MH, Toyama DO, Marangoni S, Alves CD, Barbosa PS, de Sousa Alves R, Fonteles MC, Monteiro HS." Purification and biological effects of L-amino acid oxidase isolated from Bothrops insularis venom. DRAMP02459 ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV 37 "L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)" P0DI88 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothrops jararaca (Jararaca) "Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic, Antitumor" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (L-Met, L-Leu, L-Phe, L-Ile), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, edema, apoptosis of vascular endothelial cells or tumor cell lines, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. This protein induce hemolysis and has antibacterial and antiparasitic activities (against the Gram-positive S.aureus). Tested in vivo, this protein significantly inhibits Ehrlich ascite tumors growth and induces an influx of polymorphonuclear cells, as well as spontaneous liberation of hydrogen peroxide from peritoneal macrophages. Tissue specificity: Expressed by the venom gland. Miscellaneous: Has parasiticidal activities against both trypanosomes and leishmania, as a result of enzyme-catalyzed hydrogen peroxide production." Gram-positive bacterium: S. aureus. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18346051##19101583##20615423 Basic Clin Pharmacol Toxicol. 2008 Jun;102(6):533-542.##Toxicon. 2009 Mar 1;53(3):330-341.##Toxicon. 2010 Nov;56(6):944-955. "de Vieira Santos MM, Sant'Ana CD, Giglio JR, da Silva RJ, Sampaio SV, Soares AM, Fecchio D.##Ciscotto P, Machado de Avila RA, Coelho EA, Oliveira J, Diniz CG, Faras LM, de Carvalho MA, Maria WS, Sanchez EF, Borges A, Chvez-Olrtegui C.##olindo P, Teixeira-Ferreira AS, DaMatta RA, Alves EW." "Antitumoural effect of an L-amino acid oxidase isolated from Bothrops jararaca snake venom.##Antigenic, microbicidal and antiparasitic properties of an L-amino acid oxidase isolated from Bothrops jararaca snake venom.##L-amino acid oxidase activity present in fractions of Bothrops jararaca venom is responsible for the Induction: of programmed cell death in Trypanosoma cruzi." DRAMP02460 ADDRNPLEECFRETDYEEFLEIAKNGLSTT 30 "L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)" P0DI89 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothrops leucurus (White-tailed jararaca) (White-tailed lancehead) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (high activity against L-Met, L-Leu, L-Nle, L-Trp, L-Phe and moderate activity against L-Tyr), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities (By similarity). In addition, this protein induces apoptosis. It also interacts with endothelial cells, and inhibits collagen- and ADP-induced platelet aggregation. L-LAAO family effects on platelets are controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions. Tissue specificity: Expressed by the venom gland. Miscellaneous: Has parasiticidal activities against both trypanosomes and leishmania, as a result of enzyme-catalyzed hydrogen peroxide production. Biophysicochemical properties: pH dependence (Optimum pH is 7.5-8.8 for L-Leu)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 21539897 Biochim Biophys Acta. 2011 Jul;1810(7):683-694. "Naumann GB, Silva LF, Silva L, Faria G, Richardson M, Evangelista K, Kohlhoff M, Gontijo CM, Navdaev A, de Rezende FF, Eble JA, Sanchez EF." Cytotoxicity and inhibition of platelet aggregation caused by an l-amino acid oxidase from Bothrops leucurus venom. DRAMP02461 AHDGNPLEECFREDDEEFFLEIAKNGLTATSNPKRVVIV 39 "L-amino-acid oxidase (BmarLAAO; LAAO; LAO; snakes, reptils, animals)" P0CJ40 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothrops marajoensis (Marajo lancehead) "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. In addition, this protein inhibits dose-dependently the growth of Gram-positive, Gram-negative bacteria and yeast, probably by the generation of hydrogen peroxide. Tissue specificity: Expressed by the venom gland. Miscellaneous: Has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 19944711 Toxicon. 2010 Apr 1;55(4):795-804. "Costa Torres AF, Dantas RT, Toyama MH, Diz Filho E, Zara FJ, Rodrigues de Queiroz MG, Pinto Nogueira NA, Rosa de Oliveira M, de Oliveira Toyama D, Monteiro HS, Martins AM." Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: phospholipase A2 and L-amino acid oxidase. DRAMP02462 DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKK 95 "L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)" P0DI91 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Naja oxiana (Central Asian cobra) (Oxus cobra) "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as antibacterial activity against both Gram-positive (B.subtilis) and Gram-negative (E.coli) bacteria, and inhibition of ADP- or collagen-induced platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, edema, apoptosis, and have antiparasitic activities. Tissue specificity: Expressed by the venom gland. Biophysicochemical properties: Kinetic parameters (KM=0.885 mM for L-Met; KM=0.051 mM for L-Phe; KM=0.147 mM for L-Trp; KM=0.75 mM for L-Leu)" Gram-positive bacterium: Bacillus subtilis;##Gram-negative bacterium: E. coli. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18294891 Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):572-580. "Samel M, T?nism?gi K, R?nnholm G, Vija H, Siigur J, Kalkkinen N, Siigur E." L-Amino acid oxidase from Naja naja oxiana venom. DRAMP02464 GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP 60 "L-amino-acid oxidase (LAAO, LAO; reptilia, animals)" Q6T627 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bitis gabonica (Gaboon adder) (Gaboon viper) "Antimicrobial, Antibacterial, Antiparasitic" Transcript level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 15276202 Gene. 2004 Aug 4;337:55-69. "Francischetti IM, My-Pham V, Harrison J, Garfield MK, Ribeiro JM." Bitis gabonica (Gaboon viper) snake venom gland: toward a catalog for the full-length transcripts (cDNA) and proteins. DRAMP02465 ADDINPKEECFFEDDYYEFE 20 "L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)" P86535 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Daboia russelii (Russel's viper) (Vipera russelii) "Antimicrobial, Antibacterial, Antitumor, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. Tissue specificity: Expressed by the venom gland. Biophysicochemical properties: Kinetic parameters (KM=0.297 mM for L-Met; KM=1.44 mM for L-Ile; KM=0.750 mM for L-Leu; KM=0.066 mM for L-Phe; KM=0.210 mM for L-Trp; KM=0.052 mM for L-Tyr; Vmax=8.96 ?mol/min/mg enzyme toward L-Phe)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18384385##20203422 FEBS J. 2008 May;275(9):2078-2095.##Biomed Res. 2010 Feb;31(1):71-81. "Mandal S, Bhattacharyya D.##Suzuki M, Itoh T, Anuruddhe BM, Bandaranayake IK, Shirani Ranasinghe JG, Athauda SB, Moriyama A." Two L-amino acid oxidase isoenzymes from Russell's viper (Daboia russelli russelli) venom with different mechanisms of inhibition by substrate analogs.##Molecular diversity in venom proteins of the Russell's viper (Daboia russellii russellii) and the Indian cobra (Naja naja) in Sri Lanka. DRAMP02466 ADDKNPLEECFCEDDDYCEG 20 "L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)" P0DI90 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Daboia russelii (Russel's viper) (Vipera russelii) "Antimicrobial, Antibacterial, Antitumor, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions By similarity. Tissue specificity: Expressed by the venom gland. Biophysicochemical properties: Kinetic parameters (KM=1.89 mM for L-Ile; KM=599.7 ?M for L-Leu; KM=222.8 ?M for L-Met; KM=49.3 ?M for L-Phe; KM=235.1 ?M for L-Trp; KM=538.2 ?M for L-Tyr; Vmax=6.94 ?mol/min/mg enzyme toward L-Phe)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18384385 FEBS J. 2008 May;275(9):2078-2095. "Mandal S, Bhattacharyya D." Two L-amino acid oxidase isoenzymes from Russell's viper (Daboia russelli russelli) venom with different mechanisms of inhibition by substrate analogs. DRAMP02467 ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIK 88 "L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)" P0C2D7 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Vipera berus berus (Common viper) "Antimicrobial, Antibacterial, Antitumor, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (the most specific substrate is L-Phe, followed by L-Met, L-Leu, L-Phe, L-Ile, L-Arg and L-His), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities By similarity. In addition, this protein has an ability to induce apoptosis in cultured HeLa and K562 cells, and inhibits ADP-induced platelet aggregation dose-dependently. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. Tissue specificity: Expressed by the venom gland. Biophysicochemical properties: Kinetic parameters (KM=0.361 mM for L-Leu; KM=0.286 mM for L-Met; KM=0.058 mM for L-Phe)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 16574513 Biochim Biophys Acta. 2006 Apr;1764(4):707-714. "Samel M, Vija H, R?nnholm G, Siigur J, Kalkkinen N, Siigur E." Isolation and characterization of an apoptotic and platelet aggregation inhibiting L-amino acid oxidase from Vipera berus berus (common viper) venom. DRAMP02488 ADDRNPLEEFRENNYEEFL 19 "L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)" P0DI85 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Deinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus) "Antimicrobial, Antibacterial, Antitumor, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity). Induces apoptosis in HeLa cervical cancer cells. Both the caspase-dependent and the mitochondrial pathways seem to be involved in apoptosis. Tissue specificity: Expressed by the venom gland." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 17275856 Life Sci. 2007 Mar 6;80(13):1189-1197. "Zhang L, Wei LJ." "ACTX-8, a cytotoxic L-amino acid oxidase isolated from Agkistrodon acutus snake venom, induces apoptosis in Hela cervical cancer cells." DRAMP02512 ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV 61 "L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)" P0C2D2 Not found Not found Crotalus durissus cascavella (Northeastern Brazilian rattlesnake) "Antimicrobial, Antibacterial, Antiparasitic, Cytotoxic" Protein level Not found Not found None "Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, and edema. Also has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production, and the 50% inhibitory concentration was estimated in 2.39 microg/ml." "Xanthomonas axonopodis pv passiflorae, Streptococcus mutans, Leishmania amazonensis." No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 16307769 Toxicon. 2006 Jan;47(1):47-57. "Toyama MH, Toyama Dde O, Passero LF, Laurenti MD, Corbett CE, Tomokane TY, Fonseca FV, Antunes E, Joazeiro PP, Beriam LO, Martins MA, Monteiro HS, Fonteles MC." Isolation of a new L-amino acid oxidase from Crotalus durissus cascavella venom. DRAMP02902 ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY 49 "L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)" P0C2D1 Belongs to the flavin monoamine oxidase family (FIG1 subfamily) Not found Bothrops pirajai (Piraja's lance head) "Antimicrobial, Antibacterial, Anti-Gram-, Antiparasitic" Protein level Not found Not found None "FunctionCatalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. This protein may also have activities in hemorrhage, hemolysis, and apoptosis. Tissue specificity: Expressed by the venom gland. Miscellaneous: Has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production." "Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa. Leishmania sp.." No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 16809041 Bioorg Med Chem. 2006 Oct 15;14(20):7034-7043. "Izidoro LF, Ribeiro MC, Souza GR, Sant'Ana CD, Hamaguchi A, Homsi-Brandeburgo MI, Goulart LR, Beleboni RO, Nomizo A, Sampaio SV, Soares AM, Rodrigues VM." Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom. DRAMP03064 HGVSGHGQHGVHG 13 "Alloferon-1 (Insects, animals)" P83412 Not found Not found Calliphora vicina (Blue blowfly) (Calliphora erythrocephala) "Antimicrobial, Antiparasitic, Antiviral, Antitumor" Protein level Not found Not found None "Function: Antimicrobial peptide presumably with antiparasitic, antiviral and/or Antitumoral activities. Tissue specificity: Hemolymph. Induction: By bacterial infection. Miscellaneous: Stimulates antiviral and antitumoral resistance when injected in mice. Enhances natural cytotoxicity of blood and spleen lymphocytes. Induces interferon production in mouse and human." Human influenza viruses A and B. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 12235362 Proc Natl Acad Sci U S A. 2002 Oct 1;99(20):12628-32. "Chernysh S, Kim SI, Bekker G, Pleskach VA, Filatova NA, Anikin VB, Platonov VG, Bulet P." Antiviral and antitumor peptides from insects. DRAMP03094 DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC 44 "Drosomycin-2 (Insects, animals)" No entry found Not found Not found Drosophila melanogaster (Fruit fly) "Antimicrobial, Antifungal, Antiparasitic" Not found Not found Not found None "Function: Drosomycin-2 is antiparasitic peptide which shows inhibitory effect on the ookinete development of the parasite Plasmodium berghei. Induction: Expressed in larva, pupa and adult." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18657321 Mol Immunol. 2008 Sep;45(15):3909-3916. "Tian C, Gao B, Rodriguez Mdel C, Lanz-Mendoza H, Ma B, Zhu S." "Gene expression, antiparasitic activity, and functional evolution of the drosomycin family." DRAMP18210 SCNCVCGVCCSC 12 Amythiamicin C/D(Bacteriocin) P0C912 Belongs to the class I bacteriocin Not found Amycolatopsis sp. (strain MI481-42F4 / FERM P-12739) "Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic" Not found "The main frame from C-1 to C-41 of these antibiotics was the same as that of amythiamicin D. Amino acid autoanalyses of amythiamicins A, B and C showed that these have another one mole of serine and proline in comparison with amythiamicin D. Stereochemistries of both amino acids were determined to be L by chiral HPLC. These seryl-prolyl residues in amythiamicins A, B and C are attached at C-41 through an oxazoline ring, amide and ester " None "Sequence uncertainty (position 4): C or T. Function: Has bacteriocidal activity against Gram-positive bacteria: including multi-drug resistant strains such as Staphylococcus aureus MS9610 and Methicillin-resistant S.aureus, but is not active against most Gram-negative bacteria and fungi." Gram-positive No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Elongation Factor Tu (EF-Tu) 8040071##7961166##16262432 J Antibiot (Tokyo). 1994 Jun;47(6):668-74.##J Antibiot (Tokyo). 1994 Oct;47(10):1153-9.##J Am Chem Soc. 2005 Nov 9;127(44):15644-51. "Shimanaka K, Kinoshita N, Iinuma H, Hamada M, Takeuchi T.##Shimanaka K, Takahashi Y, Iinuma H, Naganawa H, Takeuchi T.##Hughes RA, Thompson SP, Alcaraz L, Moody CJ." "Novel antibiotics, amythiamicins. I. Taxonomy, fermentation, isolation, physico-chemical properties, and antimicrobial activity.##Novel antibiotics, amythiamicins. III. Structure elucidations of amythiamicins A, B and C.##Total synthesis of the thiopeptide antibiotic amythiamicin D." DRAMP03469 MDVVRTLILCVCLFGLTFA 19 "Serine protease inhibitor Cvsi-1 (molluscs, animals)" "Q30HU9, P84574" Not found Not found Crassostrea virginica (Eastern oyster) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Slow-binding inhibitor of serine proteases. The inhibitor rapidly binds to the protease forming a weak enzyme-inhibitor complex, and this is followed by a slow isomerization forming a tight-binding enzyme-inhibitor complex. Active against subtilisin A, perkinsin and trypsin with dissociation constants of 0.29 nM, 13.7 nM and 17.7 nM respectively. Not active against thermolysin, papain or pepsin. Has antiparasitic activity against the protozoan P. marinus. Tissue specificity: Detected in hemolymph (at protein level). In oysters collected in the summer the expression level is highest in the digestive gland with low levels of expression in gill, mantle, labial palp, style-sac midgut, gonad, heart, and hemocyte. In winter expression levels are higher in all tissues with highest expression levels observed in the digestive gland. Within the digestive gland expression is limited to the basophil cells of the digestive diverticula." Subtilisin A and Prochlorococcus marinus. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 16872855##19720077 Comp Biochem Physiol B Biochem Mol Biol. 2006 Sep;145(1):16-26.##Dev Comp Immunol. 2010 Jan;34(1):84-92. "Xue QG, Waldrop GL, Schey KL, Itoh N, Ogawa M, Cooper RK, Losso JN, La Peyre JF.##La Peyre JF, Xue QG, Itoh N, Li Y, Cooper RK." "A novel slow-tight binding serine protease inhibitor from eastern oyster (Crassostrea virginica) plasma inhibits perkinsin, the major extracellular protease of the oyster protozoan parasite Perkinsus marinus.##Serine protease inhibitor cvSI-1 potential role in the eastern oyster host defense against the protozoan parasite Perkinsus marinus." DRAMP03557 GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL 83 "Granulysin (Lymphokine LAG-2; Human, mammals, animals)" P22749 Not found GNLY Homo sapiens (Human) "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Protein level Alpha helix Not found 1L9L resolved by X-ray. "Function: Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. Tissue specificity: Expressed in natural killer and T-cells. Induction: By T-cell growth factor and IL2/interleukin-2." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 9756476##12488100 Science. 1998 Oct 2;282(5386):121-125.##J Mol Biol. 2003 Jan 10;325(2):355-365. "Stenger S, Hanson DA, Teitelbaum R, Dewan P, Niazi KR, Froelich CJ, Ganz T, Thoma-Uszynski S, Melin A, Bogdan C, Porcelli SA, Bloom BR, Krensky AM, Modlin RL.##Anderson DH, Sawaya MR, Cascio D, Ernst W, Modlin R, Krensky A, Eisenberg D." An antimicrobial activity of cytolytic T cells mediated by granulysin.##Granulysin crystal structure and a structure-derived lytic mechanism. DRAMP03558 EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES 70 "human platelet factor 4 (hPF4; Human, mammals, animals)" No entry found Belongs to the intercrine alpha (chemokine CxC) family Not found Homo sapiens (Human) Antiparasitic Not found Not found Not found None Function: human platelet factor 4 (hPF4) kills malaria parasites inside erythrocytes by selectively lysing the parasite digestive vacuole (DV). No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 23245326 Cell Host Microbe. 2012 Dec 13;12(6):815-823. "Love MS, Millholland MG, Mishra S, Kulkarni S, Freeman KB, Pan W, Kavash RW, Costanzo MJ, Jo H, Daly TM, Williams DR, Kowalska MA, Bergman LW, Poncz M, DeGrado WF, Sinnis P, Scott RW, Greenbaum DC." Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials. DRAMP03559 VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP 77 "CXCL10 (Human, mammals, animals)" "P02778, Q96QJ5" Belongs to the intercrine alpha (chemokine CxC) family CXCL10 Homo sapiens (Human) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Combine helix and beta structure Not found "1O80,1O7Z,1O7Y resolved by X-ray.##1LV9 resolved by NMR." Function: Chemotactic for monocytes and T-lymphocytes. No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Binds to CXCR3 12949249##12737818 J Leukoc Biol. 2003 Sep;74(3):448-455.##Structure. 2003 May;11(5):521-32. "Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.##Swaminathan GJ, Holloway DE, Colvin RA, Campanella GK, Papageorgiou AC, Luster AD, Acharya KR." Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.##Crystal structures of oligomeric forms of the IP-10/CXCL10 chemokine. DRAMP03560 TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN 69 "CXC chemokine GRObeta [5-73] (Human, mammals, animals)" P19875 Belongs to the intercrine alpha (chemokine CxC) family CXCL2 Homo sapiens (Human) "Antimicrobial, Antibacterial, Antiparasitic, Chemotactic" Protein level Combine helix and beta structure "GRObeta [5-73] forms a dimer in solution that is architectured by a six-stranded antiparallel beta-sheet (residues 25 to 29, 39 to 44, 49 to 52) and a pair of helices (residues 58 to 68) with 2-fold symmetry, while the C terminus of the protein is disordered.(Ref.2)" 1QNK resolved by NMR. "Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. PTM: The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. Pharmaceutical use: GRO-beta(5-73) is available under the name Garnocestim as immunomodulator. It is used prior to hematopoietic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy induced cytopenias." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 12949249##10600366 J Leukoc Biol. 2003 Sep;74(3):448-455.##J Mol Biol. 1999 Dec 17;294(5):1065-1072. "Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ.##Qian YQ, Johanson KO, McDevitt P." Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.##Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8. DRAMP03561 GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN 77 "CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals)" P80162 Belongs to the intercrine alpha (chemokine CxC) family CXCL6 Homo sapiens (Human) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None Function: Chemotactic for neutrophil granulocytes. No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Heparin-binding 18443119 Antimicrob Agents Chemother. 2008 Jul;52(7):2599-2607. "Linge HM, Collin M, Nordenfelt P, M?rgelin M, Malmsten M, Egesten A." The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial. DRAMP18202 LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP 46 "WB Piscidin 5 (fish, animals)" E3UVF7(Precursor) Belongs to the defensin family Not found Morone chrysops "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic" Not found Not found None No more comments Staphylococcus aureus ATCC 29213(MIC 4.52uM) No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Lipid-binding 27552222 PLoS One. 11(8):e0159423(2016) "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes. DRAMP18200 FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP 55 "SB Piscidin 6 (fish, animals)" No entry found Belongs to the defensin family Not found Morone saxatilis "Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic" Not found Not found None No more comments Staphylococcus aureus ATCC 29213(MIC >32.11uM) No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Lipid-binding 27552222 PLoS One. 11(8):e0159423(2016) "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes. DRAMP18201 LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP 55 "WB Piscidin 6 (fish, animals)" No entry found Belongs to the defensin family Not found Morone chrysops "Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic" Not found Not found None No more comments Staphylococcus aureus ATCC 29213(MIC >31.59uM) No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Lipid-binding 27552222 PLoS One. 11(8):e0159423(2016) "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes. DRAMP03611 KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ 48 "Beta-defensin 110 (Beta-defensin 10, DEFB-10; Defensin, beta 110; Human, mammals, animals)" "Q30KQ9, Q30KR0" Belongs to the beta-defensin family DEFB110 Homo sapiens (Human) "Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic" Transcript level Bridge Not found None "Function: Has antibacterial activity. PTM: Contains three disulfide bonds (By similarity)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 16033865 Physiol Genomics. 2005 Sep 21;23(1):5-17. "Patil AA, Cai Y, Sang Y, Blecha F, Zhang G." Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract. DRAMP04673 PAAAAQAVAGLAPVAAEQ 18 Alamethicin (ALM; fungi) No entry found Not found Not found Trichoderma viride "Antimicrobial, Antibacterial, Antifungal, Antiparasitic" Not found Alpha helix The molecular conformation of the three crystallographically independent molecules is largely alpha-helical with a bend in the helix axis at an internal proline residue. The helix structure is highly amphipathic as most of the solvent-accessible polar atoms lie on a narrow strip of surface parallel to the helix axis.(Ref.2) 1AMT resolved by X-ray. Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found PubMed ID is not available##6292726 "Experientia, 1967; 23: 85-86.##Nature. 1982 Nov 25;300(5890):325-330." "Meyer CE, Reusser F.##Fox RO Jr, Richards FM." Polypeptide anti-bacterial agent isolated from Trichoderma viride.##A voltage-gated ion channel model inferred from the crystal structure of alamethicin at 1.5-A resolution. DRAMP04700 DLWQFGKMILKVAGKLPFPYYGAYGCYCGWGGRGKPKDPTDRCCFVHDCC 50 "Basic phospholipase A2 BnpTX-1 (BnPTx-I, svPLA2; Phosphatidylcholine 2-acylhydrolase)" P0DM51 Belongs to the phospholipase A2 family (Group II subfamily D49 sub-subfami Not found Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedipauloensis) "Antimicrobial, Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-" Protein level Not found Not found None "Function: Snake venom phospholipase A2 (PLA2). In vitro, shows anticoagulant activity and induces cytotoxicity when tested on C2C12 myoblasts/myotubes. In vivo, when tested on mice, induces myotoxicity (intramuscular injection), edema (injection in the subplantar region) and lethality. Also induces neurotoxic effect on mouse neuromuscular preparations and has bactericidal activity on the Gram-negative bacteria E.coli (ATCC29648) and the Gram- positive S.aureus (ATCC 25923). The catalytic and anticoagulant activities of BnpTX-I are higher than those of BnpTX-II. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Toxic Dose: LD(50) is 5.1 +/- 1.3 mg/kg by intraperitoneal injection into mice. LD(50) is 2.3 +/- 0.8 mg/kg by intravenous injection into mice. Miscellaneous: Has a pI of approximately 7.8 and about 121 amino acids (PubMed:15302537). PTM: Contains seven disulfide bonds." Gram-negative bacterium: E. coli ATCC29648 and Gram-positive bacterium: S. aureus ATCC 25923. No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 15302537 Toxicon. 2004 Sep 1;44(3):305-314. "Rodrigues VM, Marcussi S, Cambraia RS, de Arajo AL, Malta-Neto NR, Hamaguchi A, Ferro EA, Homsi-Brandeburgo MI, Giglio JR, Soares AM." Bactericidal and neurotoxic activities of two myotoxic phospholipases A2 from Bothrops neuwiedi pauloensis snake venom. DRAMP04701 SLLELGKMILQETGKMPSKSYGAYGCNCGVLGR 33 "Phospholipase A2 homolog (BmarPLA2, svPLA2 homolog)" P0DI92 Belongs to the phospholipase A2 family (Group II subfamily) Not found Bothrops marajoensis (Marajo lancehead) "Antimicrobial, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Snake phospholipase A2 homolog that lacks enzymatic activity. May display myotoxin activity. Does not show antimicrobial activity. PTM: Contains seven disulfide bonds (By similarity)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 19944711 Toxicon. 2010 Apr 1;55(4):795-804. "Costa Torres AF, Dantas RT, Toyama MH, Diz Filho E, Zara FJ, Rodrigues de Queiroz MG, Pinto Nogueira NA, Rosa de Oliveira M, de Oliveira Toyama D, Monteiro HS, Martins AM." Antibacterial and antiparasitic effects of Bothrops marajoensis venom and its fractions: Phospholipase A2 and L-amino acid oxidase. DRAMP18132 ADPRNPLEECFRETD 15 L-amino-acid oxidase Bfon20 (LAAO; LAO) P0DMG9 Belongs to the flavin monoamine oxidase family Not found Bothrops fonsecai (Fonseca's lancehead) (Rhinocerophis fonsecai) "Antimicrobial, Antitumor, Antibacterial, Antiparasitic" Protein level Not found Not found None "Function: Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity)." No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 18760386 J. Proteomics 71:473-485 (2008). "Tashima A.K., Sanz L., Camargo A.C. , Serrano S. M. , Calvete J.J." Snake venomics of the Brazilian pitvipers Bothrops cotiara andBothrops fonsecai. Identification of taxonomy markerS. DRAMP18421 GFGCPKSALSCSQQCRENNTHSGGYCNGPFNIVCSCY 37 "DefMT7 (defensin MT7; hard ticks, arachnids, arthropods, invertebrates, animals)" No entry found Belongs to the defensin family. Not found Ixodes ricinus "Antiparasitic, Antimalarial" Bridge Not found None Fuction: The peptide showed no activity against bacteria. It showed antimalarial activity. No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27822206##26255244 Front Microbiol. 2016 Oct 24;7:1682. ##Dev Comp Immunol. 2015 Dec;53(2):358-65. "Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald" Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.##Ixodes ricinus defensins attack distantly-related pathogens. DRAMP18422 GYFCPYNGYCDHHCRKKLRWRGGYCGGRWKLTCICVRG 38 "DefMT2 (defensin MT2;hard ticks, arachnids, arthropods, invertebrates, animals)" No entry found Belongs to the defensin family. Not found Ixodes ricinus "Antiparasitic, Antimalarial" Bridge Not found None Fuction: The peptide showed no activity against bacteria. It showed antimalarial activity. No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27822206##26255244 Front Microbiol. 2016 Oct 24;7:1682. ##Dev Comp Immunol. 2015 Dec;53(2):358-65. "Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald" Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.##Ixodes ricinus defensins attack distantly-related pathogens. DRAMP18426 GVIDIIKGAGKDLIAHAIGKLAEKV 25 "Ocellatin-PT3 (frog, amphibians, animals)" No entry found Not found Not found "Skin Secretion, dorsal, Leptodactylus pustulatus" Antiparasitic Helix Not found None Fuction: It has leishmanicidal activity. No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 26107622##27463422 J Nat Prod. 2015 Jul 24;78(7):1495-504. ##Biopolymers. 2016 Dec;105(12):873-86. "Marani MM, Dourado FS, Quelemes PV, de Araujo AR, Perfeito ML, Barbosa EA, V" Characterization and Biological Activities of Ocellatin Peptides from the Skin Secretion of the Frog Leptodactylus pustulatus. ##Ocellatin-PT antimicrobial peptides: High-resolution microscopy studies in antileishmania models and interactions with mimetic membrane systems. DRAMP18438 FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP 55 "SB Piscidin 6 (fish, animals)" No entry found Not found Not found Morone saxatilis "Antimicrobial, Antibacterial, Antiparasitic" Not found Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27552222 PLoS One. 2016 Aug 23;11(8):e0159423. "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes DRAMP18439 LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP 55 "WB Piscidin 6 (fish, animals)" No entry found Not found Not found Morone chrysops "Antimicrobial, Antibacterial, Antiparasitic" Not found Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27552222 PLoS One. 2016 Aug 23;11(8):e0159423. "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes DRAMP18440 LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP 46 "WB Piscidin 5 (fish, animals)" No entry found Not found Not found Morone chrysops "Antimicrobial, Antibacterial, Antiparasitic" Not found Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27552222 PLoS One. 2016 Aug 23;11(8):e0159423. "Salger SA, Cassady KR, Reading BJ, Noga EJ" A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes DRAMP18419 GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG 55 STiDA-2 No entry found Belongs to the defensin family. Not found Deduced; synthetic Antiparasitic Bridge Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27822206 Front Microbiol. 2016 Oct 24;7:1682 "Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald" Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins. DRAMP18420 GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKTRPPFILG 55 STiDA-1 No entry found Belongs to the defensin family. Not found Deduced; synthetic "Antiparasitic, Antimalarial" Bridge Not found None Comment: No comments found on DRAMP database No MICs found in DRAMP database No hemolysis information or data found in the reference(s) presented in this entry Not included yet Not included yet Not included yet Not included yet Not included yet Not included yet Not found 27822206 Front Microbiol. 2016 Oct 24;7:1682 "Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald" Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins. DRAMP20933 FFSLIPSLVGGLISAFK 17 Stigmurin No entry found Derived from scorpion venom peptide Not found Tityus stigmurus "Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiparasitic, Antiproliferative" Transcript level Alpha helix Not found None Function: Antibacterial activity against the Gram-positive bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells. "[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=9.38 M), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 M);##yeasts: Candida albicans ATCC 90028 (MIC=37.5 M);##Stigmurin inhibit 90% of the epimastigote forms of Trypanosoma cruzi growth at 25 ?M;##HeLa cell line: IC50=7.98 M" "[Ref.29670004]Hemolysis 0% at 1.17 M, hemolysis 1% at 2.34 M, hemolysis 1% at 4.69 M, hemolysis 0% at 9.38 M, hemolysis 1% at 18.75 M, hemolysis 1% at 37.50 M, hemolysis 3% at 75.00 M against human red blood cell" Linear Free Amidation None L "[Ref.29670004] The cell viability of HeLa cell lines is 56%, 66%, 66%, 81%, 78%, 66% and 30% at peptide concentrations of 2, 4, 8, 10, 15, 20 and 40 M. ##The cell viability of 3T3 cell lines is 81%, 63%, 51%, 29%, 27%, 19% and 15% at peptide concentra" Not found 29670004 Toxins (Basel). 2018 Apr 18;10(4). pii: E161. "Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Jnior AA, Silva MS, Fernandes-Pedrosa MF." "Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity." DRAMP20957 FFSLIPKLVKGLISAFK 17 StigA6 No entry found Derived from scorpion venom peptide Not found Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antiproliferative" Synthetic Alpha helix "The peptide adopts helical conformation with some random structure at the N- and C-terminals. In sodium phosphate buffer (PBS) and water they have a predominantly random structure, but in 20 mM sodium dodecyl sulfate (SDS) and 2,2,2-trifluoroethanol (TFE) they have a typical alpha-helix structure." None Function: Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells. "[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=2.34 M), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 M), Enterococcus faecalis ATCC 4028 (MIC=1.17 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=4.69 M), Enterobacter cloacae ATCC 13047 (MIC=18.75 M), Pseudomonas aeruginosa ATCC 27853 (MIC=9.38 M);##yeasts: Candida albicans ATCC 90028 (MIC=9.38 M), Candida krusei ATCC 6258 (MIC=37.5 M), Candida glabrata ATCC 90030 (MIC=18.75 M);##StigA6 inhibit 100% of the epimastigote forms of Trypanosoma cruzi growth at 2.5 ?M;##HeLa cell line: IC50=14.01 ?M" "[Ref.29670004] Hemolysis 0% at 1.17 M, hemolysis 2% at 2.34 M, hemolysis 15% at 4.69 M, hemolysis 27% at 9.38 M, hemolysis 30% at 18.75 M, hemolysis 30% at 37.50 M, hemolysis 27% at 75.00 M against human red blood cells" Linear Free Amidation None L "[Ref.29670004] The cell viability of HeLa cell lines is 19%, 15%, 11%, 29%, 9%, 13% and 8% at peptide concentrations of 2, 4, 8, 10, 15, 20 and 40 M. ##The cell viability of 3T3 cell lines is 81%, 73%, 69%, 61%, 51%, 20% and 15% at peptide concentrati" Not found 29670004 Toxins (Basel). 2018 Apr 18;10(4). pii: E161. "Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Jnior AA, Silva MS, Fernandes-Pedrosa MF." "Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity." DRAMP20958 FFKLIPKLVKGLISAFK 17 StigA16 No entry found Derived from scorpion venom peptide Not found Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antiproliferative" Synthetic Alpha helix "The peptide adopts helical conformation with some random structure at the N- and C-terminals. In sodium phosphate buffer (PBS) and water they have a predominantly random structure, but in 20 mM sodium dodecyl sulfate (SDS) and 2,2,2-trifluoroethanol (TFE) they have a typical alpha-helix structure." None Function: Antibacterial activity against the Gram-positive and Gram-negative bacteria. Antifungal activity against yeasts.Antiparasitic Activity against epimastigote forms of Trypanosoma cruzi. Antiproliferative Activity against HeLa cells. "[Ref.29670004] Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=2.34 M), Staphylococcus epidermidis ATCC 122225 (MIC=9.38 M), Enterococcus faecalis ATCC 4028 (MIC=1.17 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=2.34 M), Enterobacter cloacae ATCC 13047 (MIC=9.38 M), Pseudomonas aeruginosa ATCC 27853 (MIC=1.17 M);##yeasts: Candida albicans ATCC 90028 (MIC=4.69 M), Candida krusei ATCC 6258 (MIC=9.38 M), Candida glabrata ATCC 90030 (MIC=9.38 M);##StigA16 inhibit 100% of the epimastigote forms of Trypanosoma cruzi growth at 2.5 ?M;##HeLa cell line: IC50=13.01 ?M" "[Ref.29670004] Hemolysis 0% at 1.17 [Ref.29670004] Hemolysis 0% at 1.17 M, hemolysis 2% at 2.34 M, hemolysis 10% at 4.69 M, hemolysis 20% at 9.38 M, hemolysis 35% at 18.75 M, hemolysis 37% at 37.50 M, hemolysis 40% at 75.00 M against human red blood cells" Linear Free Amidation None L "[Ref.29670004] The cell viability of HeLa cell lines is 15%, 21%, 16%, 9%, 8%, 10% and 11% at peptide concentrations of 2, 4, 8, 10, 15, 20 and 40 M. ##The cell viability of 3T3 cell lines is 69%, 77%, 62%, 47%, 21%, 15% and 15% at peptide concentratio" Not found 29670004 Toxins (Basel). 2018 Apr 18;10(4). pii: E161. "Parente AMS, Daniele-Silva A, Furtado AA, Melo MA, Lacerda AF, Queiroz M, Moreno C, Santos E, Rocha HAO, Barbosa EG, Carvalho E, Silva-Jnior AA, Silva MS, Fernandes-Pedrosa MF." "Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity."