DRAMP_ID Sequence Hiden_Sequence Original_Sequence Sequence_Length Name Uniprot_Entry Family Source Activity Protein_Existence Secondary_Structure Structure_Description PDB_ID Comments Target_Organism Hemolytic_Activity Linear/Cyclic N_terminal_Modification C_terminal_Modification Special_Amino_Acid_and_Stapling_Position Stereochemistry Cytotoxicity Pubmed_ID Reference Author Title Specific_Type Nucleotide_Sequence Full_Sequence lfcMLE padj Workflow DRAMP21468 KFF?KLK?AVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 2 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 8 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 16 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 16 g/mL)" [Ref.32216308] It has 1.9% hemolysis against human red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 4 and 8) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (4) and ? (8) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21469 KFF?KLKKAV?KGFKKFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 3 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 8 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 8 g/mL), Listeria monocytogenes (MIC99.9= 8 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 16 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 1.1% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 4 and 11) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (4) and ? (11) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21470 KFFK?LKKAVK?GFKKFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 4 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 8 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 8 g/mL), Listeria monocytogenes (MIC99.9= 4 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 1.3% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 5 and 12) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (5) and ? (12) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21471 KFFKKL?KAV?KGFKKFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 5 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 8 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 8 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 4 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 16 g/mL)" [Ref.32216308] It has 5.4% hemolysis against red blood cells at peptide concentration of 320 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 7 and 11) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (7) and ? (11) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21472 KFFKKLK?AVK?GFKKFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 6 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 2.9% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 8 and 12) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (8) and ? (12) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21473 KFFKKLK?AVKKGF?KFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 7 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 16 g/mL), Listeria monocytogenes (MIC99.9= 8 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 16 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 2.6% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 8 and 15) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (8) and ? (15) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21474 KFFKKLKKAV?KGF?KFAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 8 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 2.7% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 11 and 15) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (11) and ? (15) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21475 KFFKKLKKAVK?GFKKFA?V KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 9 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 8 g/mL), Listeria monocytogenes (MIC99.9= 4 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 16 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 16 g/mL)" [Ref.32216308] It has 5.4% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 12 and 19) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (12) and ? (19) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21476 KFFKKLKKAVK?GFK?FAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 10 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 41% -helical content in 30 mM SDS. Random coils in PBS "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Stapled peptides 10 and 12 had a high content of -helix of about 41 and 45%, respectively, respectively, which could partly explain their strong antibacterial activity and proteolytic resistance." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 2.8% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 12 and 16) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (12) and ? (16) are cross-linked by a (E)-but-2-enyl space employing the N-alkylation reactionr. L "[Ref.32216308] The cell survial of HEK 293T cell line induced by peptide 10 is 101.8%, 100.7%, 98.9%, 89.1% and 83.9%." 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21477 KFFKKLKKAVKKGF?KFA?V KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 11 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 8 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 2 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 4 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 16 g/mL)" [Ref.32216308] It has 0.5% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation The ? (position: 15 and 19) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (15) and ? (19) are cross-linked by a (E)-but-2-enyl spacer employing the N-alkylation reaction. L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21478 KFFKKLKKAVK?GFK?FAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 12 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 45% -helical content in 30 mM SDS. Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Stapled peptides 10 and 12 had a high content of -helix of about 41 and 45%, respectively, respectively, which could partly explain their strong antibacterial activity and proteolytic resistance." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 2 g/mL), Listeria monocytogenes (MIC99.9= 4 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 4 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 8 g/mL)" [Ref.32216308] It has 8.7% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation "The ? (position: 12 and 16) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (12) and ? (16) are cross-linked by a 1,2-bismethylenebenzene spacer employing the N-alkylation." L "[Ref.32216308] The cell survial of HEK 293T cell line induced by peptide 12 is 102.9%, 101.8%, 101.5%, 66.4% and 62.8%." 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21479 KFFKKLKKAVK?GFK?FAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 13 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 4 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 6.1% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation "The ? (position: 12 and 16) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (12) and ? (16) are cross-linked by a 1,3-bismethylenebenzene spacer employing the N-alkylation." L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21480 KFFKKLKKAVK?GFK?FAKV KFFKKLKKAVKKGFKKFAKV KFFKKLKKAVKKGFKKFAKV 20 peptide 14 (derived from OH-CM6) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Random coils in PBS. "All the peptides were random coils in PBS but displayed varied levels of -helicity in the presence of 30 mM SDS. Other stapled peptides had an -helix content ranging from 16 to 38%, but their antibacterial activity and proteolytic stability were quite similar." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.32216308] Gram-positive bacteria: Staphylococcus aureus (MIC99.9= 4 g/mL), methicillin-resistant Staphylococcus aureus (MIC99.9= 4 g/mL), Listeria monocytogenes (MIC99.9= 4 g/mL);##Gram-negative bacteria: E.coli (MIC99.9= 8 g/mL), Pseudomonas aeruginosa (MIC99.9= 8 g/mL), clinically isolated drug-resistant E.coli (MIC99.9= 32 g/mL)" [Ref.32216308] It has 6.8% hemolysis against red blood cells at peptide concentration of 320 g/mL Cyclic (Stapled) Free Amidation "The ? (position: 12 and 16) in sequence indicates N-o-Ns-N-Fmoc-lysine before stapling. ? (12) and ? (16) are cross-linked by a 1,4-bismethylenebenzene spacer employing the N-alkylation." L No cytotoxicity information found in the reference 32216308 J Med Chem. 2020 Apr 23;63(8):4081-4089. doi: 10.1021/acs.jmedchem.9b02025. Epub 2020 Apr 8. "Hong Li, Yuchen Hu, Qi Pu, Tong He, Qianyu Zhang, Wen Wu, Xuefeng Xia and Jinqiang Zhang" Novel Stapling by Lysine Tethering Provides Stable and Low Hemolytic Cationic Antimicrobial Peptides Stapled AMP DRAMP21482 KKKKKKAAF?AWA?FAA KKKKKKAAFXAWAXFAA KKKKKKAAFAAWAAFAA 17 S-6K-F17 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A Random coils with only a small amount of helical structure in aqueous buffer. ڦ-helix in SDS detergent micelles. "Similarly, the stapled peptide, S-6K-F17 is predominantly random coil in aqueous buffer with only a small amount of helical structure despite the presence of the staple - a feature likely due to the large stretch of non-helical Lys residues that flank the stapled portion of the sequence. As expected, in detergent micelles S-6K-F17 adopts a helical structure, paralleling the unstapled peptide." Not found Function: Antibacterial activity against Gram-negative bacteria. No experiments about antibacterial activity against Gram-positive bacteria are recorded. [Ref.29275987] Gram-negative bacteria: E. coli (MIC= 1.0 M) [Ref.29275987] MHC = 3.8 M against human red blood cells. Note: Minimum hemolytic concentration (MHC) is the minimum peptide concentration at which red blood cells undergo > 2% hemolysis. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) in sequence indicates 2-(4'-pentenyl) alanine. ? (10) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 29275987 Bioorg Med Chem. 2018 Mar 15;26(6):1189-1196. doi: 10.1016/j.bmc.2017.10.020. Epub 2017 Oct 21. "Tracy A Stone, Gregory B Cole, Huong Q Nguyen, Simon Sharpe, Charles M Deber" Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides Stapled AMP DRAMP21483 KKKKKKAGF?AWA?FGA KKKKKKAGFXAWAXFGA KKKKKKAAFAAWAAFAA 17 S-6K-F17-2G No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A Lack of significant structure "Substitutions with polar, known 'helix-breaker' Gly residues led to losses in helical character until finally the peptide containing 3 Gly and 1 Asn (S-6K-F17-3GN) shows a severe loss in helical structure" Not found Function: Antibacterial activity against Gram-negative bacteria. No experiments about antibacterial activity against Gram-positive bacteria are recorded. [Ref.29275987] Gram-negative bacteria: E. coli (MIC= 1.6 M) [Ref.29275987] MHC = 15 M against human red blood cells. Note: Minimum hemolytic concentration (MHC) is the minimum peptide concentration at which red blood cells undergo > 2% hemolysis. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) in sequence indicates 2-(4'-pentenyl) alanine. ? (10) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 29275987 Bioorg Med Chem. 2018 Mar 15;26(6):1189-1196. doi: 10.1016/j.bmc.2017.10.020. Epub 2017 Oct 21. "Tracy A Stone, Gregory B Cole, Huong Q Nguyen, Simon Sharpe, Charles M Deber" Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides Stapled AMP DRAMP21484 KKKKKKAGF?AWG?FGA KKKKKKAGFXAWGXFGA KKKKKKAAFAAWAAFAA 17 S-6K-F17-3G No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A Lack of significant structure "Substitutions with polar, known 'helix-breaker' Gly residues led to losses in helical character until finally the peptide containing 3 Gly and 1 Asn (S-6K-F17-3GN) shows a severe loss in helical structure" Not found Function: Antibacterial activity against Gram-negative bacteria. No experiments about antibacterial activity against Gram-positive bacteria are recorded. [Ref.29275987] Gram-negative bacteria: E. coli (MIC= 4.2 M) [Ref.29275987] MHC = 128 M against human red blood cells. Note: Minimum hemolytic concentration (MHC) is the minimum peptide concentration at which red blood cells undergo > 2% hemolysis. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) in sequence indicates 2-(4'-pentenyl) alanine. ? (10) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 29275987 Bioorg Med Chem. 2018 Mar 15;26(6):1189-1196. doi: 10.1016/j.bmc.2017.10.020. Epub 2017 Oct 21. "Tracy A Stone, Gregory B Cole, Huong Q Nguyen, Simon Sharpe, Charles M Deber" Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides Stapled AMP DRAMP21485 KKKKKKNGF?AWG?FGA KKKKKKNGFXAWGXFGA KKKKKKAAFAAWAAFAA 17 S-6K-F17-3GN No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A Lack of significant structure "Substitutions with polar, known 'helix-breaker' Gly residues led to losses in helical character until finally the peptide containing 3 Gly and 1 Asn (S-6K-F17-3GN) shows a severe loss in helical structure" Not found Function: Antibacterial activity against Gram-negative bacteria. No experiments about antibacterial activity against Gram-positive bacteria are recorded. [Ref.29275987] Gram-negative bacteria: E. coli (MIC= 4.2 M) [Ref.29275987] MHC = 587 M against human red blood cells. Note: Minimum hemolytic concentration (MHC) is the minimum peptide concentration at which red blood cells undergo > 2% hemolysis. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) in sequence indicates 2-(4'-pentenyl) alanine. ? (10) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 29275987 Bioorg Med Chem. 2018 Mar 15;26(6):1189-1196. doi: 10.1016/j.bmc.2017.10.020. Epub 2017 Oct 21. "Tracy A Stone, Gregory B Cole, Huong Q Nguyen, Simon Sharpe, Charles M Deber" Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides Stapled AMP DRAMP21486 VNWKK?LGK?IKVVK VNWKKXLGKXIKVVK VNWKKILGKIIKVVK 15 LL-IIIs-1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal" N/A 20% -helical content in water. 55% -helical content in 50% TFE. 55% -helical content in 8mM SDS. It seems that the staple in the central part of the LL-IIIs-1 analog that crosslink the bend of the -helix on its concave site around the Gly8 residue resulted in slight helix destabilization. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria and Antifungal activity against Candida albicans. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 0.7 M), Bacillus subtilis (MIC = 0.8 M), Staphylococcus aureus (MIC = 12.5 M);##Gram-negative bacteria: E.coli (MIC = 4.4 M), Pseudomonas aeruginosa (MIC = 78.7 M);##Fungi: Candida albicans (MIC = 100 M)." [Ref.22526241] LC50 = 31.3 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (6) and ? (10) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 18. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21487 VNWKKILGK?IKV?K VNWKKILGKXIKVXK VNWKKILGKIIKVVK 15 LL-IIIs-2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal" N/A 31% -helical content in water. 51% -helical content in 50% TFE. 58% -helical content in 8mM SDS. "For the LL-IIIs-2 analog, the helical content increment is slightly higher (8?%)." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria and Antifungal activity against Candida albicans. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 0.9 M), Bacillus subtilis (MIC = 1.2 M), Staphylococcus aureus (MIC = 20.3 M);##Gram-negative bacteria: E.coli (MIC = 8.8 M), Pseudomonas aeruginosa (MIC = 86.7 M);##Fungi: Candida albicans (MIC = 100 M)." [Ref.22526241] LC50 = 69 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (10) and ? (14)are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 19. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21488 V?WKK?LGKIIKVVK VXWKKXLGKIIKVVK VNWKKILGKIIKVVK 15 LL-IIIs-3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal" N/A 27% -helical content in water. 52% -helical content in 50% TFE. 62% -helical content in 8mM SDS. "The CD spectra of the singly stapled peptides of the i, i + 4 type acquired in water show a slight increase (by 5 %) of helical content in the case of MEP-Ns-1, MEP-Ns-2 and LL-IIIs-3 compared to their unstapled precursors." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria and Antifungal activity against Candida albicans. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.4 M), Bacillus subtilis (MIC = 1.1 M), Staphylococcus aureus (MIC = 21.7 M);##Gram-negative bacteria: E.coli (MIC = 1.2 M), Pseudomonas aeruginosa (MIC = 76.3 M);##Fungi: Candida albicans (MIC = 93.3 M)." [Ref.22526241] LC50 = 30 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (2) and ? (6) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 20. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21489 VN?KKI?GK?IKV?K VNXKKIXGKXIKVXK VNWKKILGKIIKVVK 15 LL-IIIs-4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 45% -helical content in water. 48% -helical content in 50% TFE. 63% -helical content in 8mM SDS. "On the other hand, the difference in -helical content between doubly stapled analogs (LL-IIIs-4, MEP-Ns-3, MEP-Ns-5, and MEP-Ns-6) and their unstapled precursors is apparently higher, on average by 15?%" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 2 M), Bacillus subtilis (MIC = 1.1 M), Staphylococcus aureus (MIC = 80 M);##Gram-negative bacteria: E.coli (MIC = 20 M), Pseudomonas aeruginosa (MIC > 100 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 > 100 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The ? (position: 3, 7, 10 and 14) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (3) and ? (7), ? (10) and ? (14) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 21. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21490 VN?KKILGK?IKVVK VNZKKILGKXIKVVK VNWKKILGKIIKVVK 15 LL-IIIs-5 cis No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 22% -helical content in water. 54% -helical content in 50% TFE. 69% -helical content in 8mM SDS. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 0.9 M), Bacillus subtilis (MIC = 0.9 M), Staphylococcus aureus (MIC = 45 M);##Gram-negative bacteria: E.coli (MIC = 3.5 M), Pseudomonas aeruginosa (MIC = 80 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 = 100 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The ? (position: 3) indicates 2-(7'-octenyl) alanine in the R configuration. The ? (position: 10) is 2-(4'-pentenyl) alanine in the S configuration. ? (3) and ? (10) are cross-linked by hydrocarbon stapling. "L, cis" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 22. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21491 VN?KKILGK?IKVVK VNZKKILGKXIKVVK VNWKKILGKIIKVVK 15 LL-IIIs-5 trans No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 26% -helical content in water. 54% -helical content in 50% TFE. 62% -helical content in 8mM SDS. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.1 M), Bacillus subtilis (MIC = 1.3 M), Staphylococcus aureus (MIC = 65 M);##Gram-negative bacteria: E.coli (MIC = 5.5 M), Pseudomonas aeruginosa (MIC = 80 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 > 100 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The ? (position: 3) indicates 2-(7'-octenyl) alanine in the R configuration. The ? (position: 10) is 2-(4'-pentenyl) alanine in the S configuration. ? (3) and ? (10) are cross-linked by hydrocarbon stapling. "L, trans" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 23. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21492 VN?KKI?PK?IKV?K VNXKKIXPKXIKVXK VNWKKILGKIIKVVK 15 LL-IIIs-6a No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 36% -helical content in water. 42% -helical content in 50% TFE. 36% -helical content in 8mM SDS. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1 M), Bacillus subtilis (MIC = 1.1 M), Staphylococcus aureus (MIC = 93 M);##Gram-negative bacteria: E.coli (MIC = 7.8 M), Pseudomonas aeruginosa (MIC = 93 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 > 100 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The ? (position: 3, 7, 10 and 14) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (3) and ? (7), ? (10) and ? (14) are cross-linked by hydrocarbon stapling respectively." "L, cis(around the S?-Pro8 peptide bond)" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 24. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21493 VN?KKI?PK?IKV?K VNXKKIXPKXIKVXK VNWKKILGKIIKVVK 15 LL-IIIs-6b No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 33% -helical content in water. 38% -helical content in 50% TFE. 35% -helical content in 8mM SDS. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 0.9 M), Bacillus subtilis (MIC = 0.8 M), Staphylococcus aureus (MIC = 50 M);##Gram-negative bacteria: E.coli (MIC = 7.8 M), Pseudomonas aeruginosa (MIC = 63 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 = 82M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The ? (position: 3, 7, 10 and 14) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (3) and ? (7), ? (10) and ? (14) are cross-linked by hydrocarbon stapling respectively." "L, trans(around the S?-Pro8 peptide bond)" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 25. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21495 GFLSILKKVLPK?JAH?K GFLSILKKVLPKXJAHXK GFLSILKKVLPKVMAHMK 18 MEP-Ns-1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal" N/A 19% -helical content in water.66% -helical content in 50% TFE. 75% -helical content in 8mM SDS. "The CD spectra of the singly stapled peptides of the i, i + 4 type acquired in water show a slight increase (by 5 %) of helical content in the case of MEP-Ns-1, MEP-Ns-2 and LL-IIIs-3 compared to their unstapled precursors." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria and Antifungal activity against Candida albicans. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 0.8 M), Bacillus subtilis (MIC = 1.1 M), Staphylococcus aureus (MIC = 10.8 M);##Gram-negative bacteria: E.coli (MIC = 2.5 M), Pseudomonas aeruginosa (MIC = 77 M);##Fungi: Candida albicans (MIC = 30 M)." [Ref.22526241] LC50 = 18.1 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The J (position: 14) in sequence indicates norleucine. The ? (position: 13 and 17) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (13) and ? (17) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 28. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21496 GFLS?LKK?LPKVJAHJK GFLSXLKKXLPKVJAHJK GFLSILKKVLPKVMAHMK 18 MEP-Ns-2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 16% -helical content in water.61% -helical content in 50% TFE. 62% -helical content in 8mM SDS. "The CD spectra of the singly stapled peptides of the i, i + 4 type acquired in water show a slight increase (by 5 %) of helical content in the case of MEP-Ns-1, MEP-Ns-2 and LL-IIIs-3 compared to their unstapled precursors." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.5 M), Bacillus subtilis (MIC = 1.2 M), Staphylococcus aureus (MIC = 37 M);##Gram-negative bacteria: E.coli (MIC = 7.8 M), Pseudomonas aeruginosa (MIC 100 M);##Fungi: Candida albicans (MIC 100 M)." [Ref.22526241] LC50 = 14.7 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The J (position: 14 and 17) in sequence indicates norleucine. The ? (position: 5 and 9) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (5) and ? (9) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 29. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21497 GFLS?LKK?LPK?JAH?K GFLSXLKKXLPKXJAHXK GFLSILKKVLPKVMAHMK 18 MEP-Ns-3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 34% -helical content in water.56% -helical content in 50% TFE. 48% -helical content in 8mM SDS. "On the other hand, the difference in -helical content between doubly stapled analogs (LL-IIIs-4, MEP-Ns-3, MEP-Ns-5, and MEP-Ns-6) and their unstapled precursors is apparently higher, on average by 15 %" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.3 M), Bacillus subtilis (MIC = 1.2 M), Staphylococcus aureus (MIC 100 M);##Gram-negative bacteria: E.coli (MIC = 46.7 M), Pseudomonas aeruginosa (MIC > 100 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 = 13.9 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The J (position: 14) in sequence indicates norleucine. ? (position: 5, 9, 13 and 17) are 2-(4'-pentenyl) alanine in the S configuration. ? (5) and ? (9), ? (13) and ? (17) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 30. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21498 GF?SILKKV?PKVJAHJK GFZSILKKVXPKVJAHJK GFLSILKKVLPKVMAHMK 18 MEP-Ns-4 cis No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Unknown No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.5 M), Bacillus subtilis (MIC = 1.3 M), Staphylococcus aureus (MIC = 37 M);##Gram-negative bacteria: E.coli (MIC = 8.1 M), Pseudomonas aeruginosa (MIC 100 M);##Fungi: Candida albicans (MIC 100 M)." [Ref.22526241] LC50 = 11 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The J (position: 14 and 17) in sequence indicates norleucine. ? (position: 10) is 2-(4'-pentenyl) alanine in the S configuration. ? (position: 3) is 2-(7'-pctenyl) lalnine in the R configuration. ? (10) and ? (3) are cross-linked by hydrocarbon stapling. "L, cis" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 31. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21499 GF?SILKKV?PKVJAHJK GFZSILKKVXPKVJAHJK GFLSILKKVLPKVMAHMK 18 MEP-Ns-4 trans No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Unknown No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 2 M), Bacillus subtilis (MIC = 1.7 M), Staphylococcus aureus (MIC = 63 M);##Gram-negative bacteria: E.coli (MIC = 16.3 M), Pseudomonas aeruginosa (MIC 100 M);##Fungi: Candida albicans (MIC 100 M)." [Ref.22526241] LC50 = 20 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation The J (position: 14 and 17) in sequence indicates norleucine. ? (position: 10) is 2-(4'-pentenyl) alanine in the S configuration. ? (position: 3) is 2-(7'-pctenyl) lalnine in the R configuration. ? (10) and ? (3) are cross-linked by hydrocarbon stapling. "L, trans" No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 32. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21500 GFLS?LKK?LGK?JAH?K GFLSXLKKXLGKXJAHXK GFLSILKKVLPKVMAHMK 18 MEP-Ns-5 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 52% -helical content in water.67% -helical content in 50% TFE. 59% -helical content in 8mM SDS. "On the other hand, the difference in -helical content between doubly stapled analogs (LL-IIIs-4, MEP-Ns-3, MEP-Ns-5, and MEP-Ns-6) and their unstapled precursors is apparently higher, on average by 15 %" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.5 M), Bacillus subtilis (MIC = 1.2 M), Staphylococcus aureus (MIC = 57 M);##Gram-negative bacteria: E.coli (MIC = 5.6 M), Pseudomonas aeruginosa (MIC > 100 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 = 29 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The J (position: 14) in sequence indicates norleucine. ? (position: 5, 9, 13 and 17) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (5) and ? (9), ? (13) and ? (17) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 33. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21501 GFLS?LKK?LAK?JAH?K GFLSXLKKXLAKXJAHXK GFLSILKKVLPKVMAHMK 18 MEP-Ns-6 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 56% -helical content in water.64% -helical content in 50% TFE. 56% -helical content in 8mM SDS. "On the other hand, the difference in -helical content between doubly stapled analogs (LL-IIIs-4, MEP-Ns-3, MEP-Ns-5, and MEP-Ns-6) and their unstapled precursors is apparently higher, on average by 15 %" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 100 M. "[Ref.22526241] Gram-positive bacteria: Micrococcus luteus (MIC = 1.5 M), Bacillus subtilis (MIC = 1.2 M), Staphylococcus aureus (MIC = 43 M);##Gram-negative bacteria: E.coli (MIC = 5.6 M), Pseudomonas aeruginosa (MIC > 100 M);##Fungi: Candida albicans (MIC > 100 M)." [Ref.22526241] LC50 = 39.5 M. Note: LC50 is the concentration of a peptide able to lyse 50% of human erthrocytes in the assay. Cyclic (Stapled) Free Amidation "The J (position: 14) in sequence indicates norleucine. ? (position: 5, 9, 13 and 17) indicates 2-(4'-pentenyl) alanine in the S configuration. ? (5) and ? (9), ? (13) and ? (17) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 22526241 Amino Acids. 2012 Nov;43(5):2047-58. doi: 10.1007/s00726-012-1283-1. Epub 2012 Apr 34. "Hubert Chapuis, Ji?ina Slaninov, Lucie Bednrov, Lenka Monincov, Milo? Bud?nsk?, Vclav ?e?ovsk?" Effect of hydrocarbon stapling on the properties of -helical antimicrobial peptides isolated from the venom of hymenoptera Stapled AMP DRAMP21502 IDWKKLL?AAK?IL IDWKKLLKAAKGIL IDWKKLLDAAKQIL 14 C-MP1-1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Slight -helical structure in aqueous solution. Increased -helical conformation in 30 mM SDS and 50% TFE compared with MPI "By CD, we observed that C-MPI-2 and MPI did not display any structural preferences in aqueous solution, whereas C-MPI-1 adopoted a slight -helical structure. C-MPI-1 also had higher -helicity than MPI in membrane mimicking environments, including 30 mM sodium dodecyl sulfate (SDS) and 50% trifluoroethyl alcohol (TFE)." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28833783] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 64 M), Bacillus subtilis ATCC 23857 (MIC = 8 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 64 M), Pseudomonas aeruginosa ATCC 27853 (No antimicrobial activity)" "[Ref.28833783] It has 0%, 0%, 2.1%, 9.5%, 22.7%, 25.4% and 34.7% against human red blood cells at peptide concentrations of 0, 5, 10, 25, 50, 75 and 150 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 8) is lysine with the methyltrityl side chain. The ? (position: 12) is propargylglycine. ? (8) and ? (12) are cross-linked by hydrocarbon stapling by 1,3-diploar azide-alkyne cyclization." L No cytotoxicity information found in the reference 28833783 J Pept Sci. 2017 Nov;23(11):824-832. doi: 10.1002/psc.3031. Epub 2017 Aug 23. "Beijun Liu,?Wei Zhang,?Sanhu Gou,?Haifeng Huang,?Jia Yao,?Zhibin Yang,?Hui Liu,?Chao Zhong,?Beiyin Liu,?Jingman Ni,?Rui Wang" Intramolecular cyclization of the antimicrobial peptide Polybia-MPI with triazole stapling: influence on stability and bioactivity Stapled AMP DRAMP21503 I?WKKLL?AAKQIL IKWKKLLGAAKQIL IDWKKLLDAAKQIL 14 C-MP1-2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A No structural preference in aqueous solution. "By CD, we observed that C-MPI-2 and MPI did not display any structural preferences in aqueous solution, whereas C-MPI-1 adopoted a slight -helical structure." Not found Function: Antibacterial activity against Gram-positive bacteria. Antibacterial activity against Gram-negative bacteria is not so evident. "[Ref.28833783] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 256 M), Bacillus subtilis ATCC 23857 (MIC = 128 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 128 M), Pseudomonas aeruginosa ATCC 27853 (No antimicrobial activity)" [Ref.28833783] No hemolytic information found. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2) is lysine with the methyltrityl side chain. The ? (position: 8) is propargylglycine. ? (2) and ? (8) are cross-linked by hydrocarbon stapling by 1,3-diploar azide-alkyne cyclization." L No cytotoxicity information found in the reference 28833783 J Pept Sci. 2017 Nov;23(11):824-832. doi: 10.1002/psc.3031. Epub 2017 Aug 23. "Beijun Liu,?Wei Zhang,?Sanhu Gou,?Haifeng Huang,?Jia Yao,?Zhibin Yang,?Hui Liu,?Chao Zhong,?Beiyin Liu,?Jingman Ni,?Rui Wang" Intramolecular cyclization of the antimicrobial peptide Polybia-MPI with triazole stapling: influence on stability and bioactivity Stapled AMP DRAMP21504 ?IGK?LHSAKKFGKAFVGEIJNS XIGKXLHSAKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)0 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 15% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 59.46 g/mL), Bacillus cereus ATCC 14579 (MIC = 10.49 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 25.00 g/mL)" [Ref.31427820] It has 5.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 1 and 5) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (1) and ? (5) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21505 G?GKF?HSAKKFGKAFVGEIJNS GXGKFXHSAKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 12% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 100.00 g/mL), Bacillus cereus ATCC 14579 (MIC = 14.87 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.72 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 12.50 g/mL)" [Ref.31427820] It has 4.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21506 GI?KFL?SAKKFGKAFVGEIJNS GIXKFLXSAKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 21% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 12.50 g/mL), Bacillus cereus ATCC 14579 (MIC = 7.43 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 10.51 g/mL)" [Ref.31427820] It has 18.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 3 and 7) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (3) and ? (7) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21507 GIG?FLH?AKKFGKAFVGEIJNS GIGXFLHXAKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 18% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 8.84 g/mL), Bacillus cereus ATCC 14579 (MIC = 10.51 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 7.43 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 25.00 g/mL)" [Ref.31427820] It has 42.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 4 and 8) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (4) and ? (8) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21508 GIGK?LHS?KKFGKAFVGEIJNS GIGKXLHSXKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 24% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 25.00 g/mL), Bacillus cereus ATCC 14579 (MIC = 6.25 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.42 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 10.51 g/mL)" [Ref.31427820] It has 18.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 5 and 9) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (5) and ? (9) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21509 GIGKF?HSA?KFGKAFVGEIJNS GIGKFXHSAXKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)5 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 14% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 25.00 g/mL), Bacillus cereus ATCC 14579 (MIC = 17.68 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 14.87 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 50.00 g/mL)" [Ref.31427820] It has 13.2% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21510 GIGKFL?SAK?FGKAFVGEIJNS GIGKFLXSAKXFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)6 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 18% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 25.00 g/mL), Bacillus cereus ATCC 14579 (MIC = 12.50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 7.43 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 29.73 g/mL)" [Ref.31427820] It has 7.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 7 and 11) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (7) and ? (11) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21511 GIGKFLH?AKK?GKAFVGEIJNS GIGKFLHXAKKXGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)7 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 26% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 6.25 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 6.25 g/mL)" [Ref.31427820] It has 62.4% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 8 and 12) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (8) and ? (12) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21512 GIGKFLHS?KKF?KAFVGEIJNS GIGKFLHSXKKFXKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)8 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 49% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 7.44 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.26 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.72 g/mL)" [Ref.31427820] It has 74.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 9 and 13) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (9) and ? (13) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21513 GIGKFLHSA?KFG?AFVGEIJNS GIGKFLHSAXKFGXAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)9 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 28% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 17.68 g/mL), Bacillus cereus ATCC 14579 (MIC = 12.50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.42 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 59.46 g/mL)" [Ref.31427820] It has 60.0% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 10 and 14) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (10) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21514 GIGKFLHSAK?FGK?FVGEIJNS GIGKFLHSAKXFGKXFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)10 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 15% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 8.84 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.42 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.42 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 14.87 g/mL)" [Ref.31427820] It has 23.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 11 and 15) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (11) and ? (15) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21515 GIGKFLHSAKK?GKA?VGEIJNS GIGKFLHSAKKXGKAXVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)11 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 16% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 12.50 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.26 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 8.84 g/mL)" [Ref.31427820] It has 17.8% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 12 and 16) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (12) and ? (16) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21516 GIGKFLHSAKKF?KAF?GEIJNS GIGKFLHSAKKFXKAFXGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)12 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 51% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 7.43 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 4.42 g/mL)" [Ref.31427820] It has 76.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 13 and 17) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (13) and ? (17) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21517 GIGKFLHSAKKFG?AFV?EIJNS GIGKFLHSAKKFGXAFVXEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)13 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 23% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 5.26 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 7.43 g/mL)" [Ref.31427820] It has 60.0% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 14 and 18) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (14) and ? (18) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21518 GIGKFLHSAKKFGK?FVG?IJNS GIGKFLHSAKKFGKXFVGXIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)14 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 19% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 2.63 g/mL), Bacillus cereus ATCC 14579 (MIC = 2.63 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.86 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.13 g/mL)" [Ref.31427820] It has 92.4% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 15 and 19) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (15) and ? (19) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21519 GIGKFLHSAKKFGKA?VGE?JNS GIGKFLHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)15 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 15% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 10.51 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.26 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 7.43 g/mL)" [Ref.31427820] It has 11.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21520 GIGKFLHSAKKFGKAF?GEI?NS GIGKFLHSAKKFGKAFXGEIXNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)16 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 11% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 42.04 g/mL), Bacillus cereus ATCC 14579 (MIC = 7.44 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.72 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 8.84 g/mL)" [Ref.31427820] It has 8.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 17 and 21) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. ? (17) and ? (21) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21521 GIGKFLHSAKKFGKAFV?EIJ?S GIGKFLHSAKKFGKAFVXEIJXS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)17 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 30% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 2.63 g/mL), Bacillus cereus ATCC 14579 (MIC = 1.86 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 5.26 g/mL)" [Ref.31427820] It has 56.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 18 and 22) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (18) and ? (22) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21522 GIGKFLHSAKKFGKAFVG?IJN? GIGKFLHSAKKFGKAFVGXIJNX GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(I+4)18 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 19% -helical content in 25-50 M potassium phosphate solution. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 1.56 g/mL), Bacillus cereus ATCC 14579 (MIC = 2.21 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 2.21 g/mL)" [Ref.31427820] It has 101.0% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 19 and 23) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (19) and ? (23) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21523 KIGKFLHSAKKFGKA?VGE?JNS KIGKFLHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(G1K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 21.02 g/mL), Bacillus cereus ATCC 14579 (MIC = 10.49 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 5.41 g/mL)" [Ref.31427820] It has 4.4% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21524 GKGKFLHSAKKFGKA?VGE?JNS GKGKFLHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(I2K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 35.36 g/mL), Bacillus cereus ATCC 14579 (MIC = 25.00 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 4.75 g/mL)" [Ref.31427820] It has 2.2% hemolysis against human red blood cells at 25 g/mL.. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21525 GIKKFLHSAKKFGKA?VGE?JNS GIKKFLHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(G3K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 10.49 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.21 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.34 g/mL)" [Ref.31427820] It has 3.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21526 GIGKKLHSAKKFGKA?VGE?JNS GIGKKLHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(F5K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 50 g/mL. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.69 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 17.68 g/mL)" [Ref.31427820] It has 1.5% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21527 GIGKFKHSAKKFGKA?VGE?JNS GIGKFKHSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(L6K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 50 g/mL. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 17.68 g/mL)" [Ref.31427820] It has 1.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21528 GIGKFLKSAKKFGKA?VGE?JNS GIGKFLKSAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(H7K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 6.20 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.21 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 2.69 g/mL)" [Ref.31427820] It has 3.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21529 GIGKFLHKAKKFGKA?VGE?JNS GIGKFLHKAKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(S8K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 6.20 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.38 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 2.65 g/mL)" [Ref.31427820] It has 3.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21530 GIGKFLHSKKKFGKA?VGE?JNS GIGKFLHSKKKFGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(A9K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 50 g/mL. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.38 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 15.81 g/mL)" [Ref.31427820] It has 1.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21531 GIGKFLHSAKKKGKA?VGE?JNS GIGKFLHSAKKKGKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(F12K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 50 g/mL. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 14.03 g/mL)" [Ref.31427820] It has 1.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21532 GIGKFLHSAKKFKKA?VGE?JNS GIGKFLHSAKKFKKAXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(G13K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 50 g/mL. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.10 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 12.82 g/mL)" [Ref.31427820] It has 1.8% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21533 GIGKFLHSAKKFGKK?VGE?JNS GIGKFLHSAKKFGKKXVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(A15K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 31.50 g/mL), Bacillus cereus ATCC 14579 (MIC = 9.89 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.10 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 4.97 g/mL)" [Ref.31427820] It has 6.5% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21534 GIGKFLHSAKKFGKA?KGE?JNS GIGKFLHSAKKFGKAXKGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(V17K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC > 50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.91 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 19.84 g/mL)" [Ref.31427820] It has 2.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21535 GIGKFLHSAKKFGKA?VKE?JNS GIGKFLHSAKKFGKAXVKEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(G18K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 8.80 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.38 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.23 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.57 g/mL)" [Ref.31427820] It has 8.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21536 GIGKFLHSAKKFGKA?VGK?JNS GIGKFLHSAKKFGKAXVGKXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(E19K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 25.00 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.21 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 2.23 g/mL)" [Ref.31427820] It has 6.0% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21537 GIGKFLHSAKKFGKA?VGE?KNS GIGKFLHSAKKFGKAXVGEXKNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(B21K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC > 50 g/mL), Bacillus cereus ATCC 14579 (MIC = 29.73 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.23 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 8.97 g/mL)" [Ref.31427820] It has 3.2% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21538 GIGKFLHSAKKFGKA?VGE?JKS GIGKFLHSAKKFGKAXVGEXJKS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(N22K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 21.02 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.38 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.60 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.57 g/mL)" [Ref.31427820] It has 11.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21539 GIGKFLHSAKKFGKA?VGE?JNK GIGKFLHSAKKFGKAXVGEXJNK GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+4)15(S23K) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 42.04 g/mL), Bacillus cereus ATCC 14579 (MIC = 7.39 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.23 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.57 g/mL)" [Ref.31427820] It has 4.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (20) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21540 G?GSF?KKKAHVGKH?GKA?LTHYL GXGSFXKKKAHVGKHXGKAXLTHYL GWGSFFKKAAHVGKHVGKAALTHYL 25 "Pleu(i+4)1,15(A9K)" No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 3.13 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.13 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 1.56 g/mL)" [Ref.31427820] It has 17.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation "The ? (position: 2, 6, 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. ? (2) and ? (6), ? (16) and ? (20) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21541 G?RKR?RKFRNKIKEKKKKIGQK?QGL?PKLA GXRKRXRKFRNKIKEKKKKIGQKXQGLXPKLA GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY 32 "CAP(i+4)1,23(L17K)" No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 12.5 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.13 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 1.56 g/mL)" [Ref.31427820] It has 4.0% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation "The ? (position: 2, 6, 24 and 28) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. ? (2) and ? (6), ? (24) and X (28) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21542 G?GKF?HSKKKFGKA?VGE?BNS GXGKFXHSKKKFGKAXVGEXBNS GIGKFLHSAKKFGKAFVGEIMNS 23 "Mag(i+4)1,15(A9K)" No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 50 g/mL), Bacillus cereus ATCC 14579 (MIC = 6.25 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.12 g/mL)" [Ref.31427820] It has 1.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation "The ? (position: 2, 6, 16 and 20) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The B (position: 21) in sequence is norlercine. ? (2) and ? (6), ? (16) and ? (20) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21543 G?FSK?KGKKIKNL?ISG?KG GXFSKXKGKKIKNLXISGXKG GIFSKLAGKKIKNLLISGLK 21 "Esc(i+4)1,14(A7K)" No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 50 g/mL), Bacillus cereus ATCC 14579 (MIC = 12.5 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.56 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 1.56 g/mL)" [Ref.31427820] It has 2.5% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation "The ? (position: 2, 6, 15 and 19) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. ? (2) and ? (6), ? (15) and ? (19) are cross-linked by hydrocarbon stapling respectively." L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21544 G?GKFLHS?KKFGKAFVGEIJNS GZGKFLHSXKKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 10.51 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.42 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.63 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.72 g/mL)" [Ref.31427820] It has 49.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 9) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 2) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (9) and ? (2) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21545 GI?KFLHSA?KFGKAFVGEIJNS GIZKFLHSAXKFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 12.50 g/mL), Bacillus cereus ATCC 14579 (MIC = 8.84 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.42 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 21.02 g/mL)" [Ref.31427820] It has 66.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 10) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 3) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (10) and ? (3) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21546 GIG?FLHSAK?FGKAFVGEIJNS GIGZFLHSAKXFGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 14.87 g/mL), Bacillus cereus ATCC 14579 (MIC = 12.50 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 10.51 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 21.02 g/mL)" [Ref.31427820] It has 52.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 11) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 4) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (11) and ? (4) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21547 GIGK?LHSAKK?GKAFVGEIJNS GIGKZLHSAKKXGKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 21.02 g/mL), Bacillus cereus ATCC 14579 (MIC = 5.26 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.21 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 6.25 g/mL)" [Ref.31427820] It has 42.5% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 12) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 5) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (12) and ? (5) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21548 GIGKF?HSAKKF?KAFVGEIJNS GIGKFZHSAKKFXKAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)5 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 8.84 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.13 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.13 g/mL)" [Ref.31427820] It has 82.9% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 13) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 6) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (13) and ? (6) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21549 GIGKFL?SAKKFG?AFVGEIJNS GIGKFLZSAKKFGXAFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)6 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 6.25 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.42 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 14.87 g/mL)" [Ref.31427820] It has 45.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 14) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 7) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (14) and ? (7) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21550 GIGKFLH?AKKFGK?FVGEIJNS GIGKFLHZAKKFGKXFVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)7 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 3.72 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 5.26 g/mL)" [Ref.31427820] It has 95.3% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 15) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 8) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (15) and ? (8) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21551 GIGKFLHS?KKFGKA?VGEIJNS GIGKFLHSZKKFGKAXVGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)8 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 6.25 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.21 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.72 g/mL)" [Ref.31427820] It has 85.2% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 16) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 9) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (16) and ? (9) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21552 GIGKFLHSA?KFGKAF?GEIJNS GIGKFLHSAZKFGKAFXGEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)9 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 3.72 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.42 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.72 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 5.26 g/mL)" [Ref.31427820] It has 94.6% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 17) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 10) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (17) and ? (10) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21553 GIGKFLHSAK?FGKAFV?EIJNS GIGKFLHSAKZFGKAFVXEIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)10 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 4.42 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.13 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 7.43 g/mL)" [Ref.31427820] It has 43.8% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 18) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 11) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (18) and ? (11) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21554 GIGKFLHSAKK?GKAFVG?IJNS GIGKFLHSAKKZGKAFVGXIJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)11 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 2.63 g/mL), Bacillus cereus ATCC 14579 (MIC = 2.63 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.21 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 2.21 g/mL)" [Ref.31427820] It has 84.7% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 19) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 12) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (19) and ? (12) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21555 GIGKFLHSAKKF?KAFVGE?JNS GIGKFLHSAKKFZKAFVGEXJNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)12 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 7.44 g/mL), Bacillus cereus ATCC 14579 (MIC = 3.72 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.21 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.13 g/mL)" [Ref.31427820] It has 75.4% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 20) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 13) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (20) and ? (13) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21556 GIGKFLHSAKKFG?AFVGEI?NS GIGKFLHSAKKFGZAFVGEIXNS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)13 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 7.44 g/mL), Bacillus cereus ATCC 14579 (MIC = 4.42 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.21 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 6.25 g/mL)" [Ref.31427820] It has 63.5% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 21) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 14) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. ? (21) and ? (14) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21557 GIGKFLHSAKKFGK?FVGEIJ?S GIGKFLHSAKKFGKZFVGEIJXS GIGKFLHSAKKFGKAFVGEIMNS 23 Mag(i+7)14 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in potassium phosphate buffer. No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.31427820] Gram-positive bacteria: Staphyolococcus aureus ATCC 25923 (MIC = 2.63 g/mL), Bacillus cereus ATCC 14579 (MIC = 1.56 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 1.86 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 5.26 g/mL)" [Ref.31427820] It has 68.1% hemolysis against human red blood cells at 25 g/mL. Cyclic (Stapled) Free Amidation The ? (position: 22) in sequence is S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 15) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The J (position: 21) in sequence is norlercine. ? (22) and ? (15) are cross-linked by hydrocarbon stapling. L No cytotoxicity information found in the reference 31427820 Nat Biotechnol. 2019 Oct;37(10):1186-1197. doi: 10.1038/s41587-019-0222-z. Epub 2019 Aug 19. "Rida Mourtada, Henry D Herce, Daniel J Yin, Jamie A Moroco, Thomas E Wales, John R Engen, Loren D Walensky" "Design of stapled antimicrobial peptides that are stable, nontoxic and kill antibiotic-resistant bacteria in mice" Stapled AMP DRAMP21558 K?WKJ?K KXWKJXK / 7 KKK No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "[Ref.30361948] All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices. [Ref.28547390] Peptide NLE and LYS maintained a compatible helicity to LEU." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC= 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysenteriae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumoniae ATCC 10031 (MIC = 18.8 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M).##[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 6.3 g/mL), Staphylococcus aureus (MIC = 6.3 g/mL), Staphylococcus epidermidis (MIC = 12.5 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 12.5 g/mL), Shigella dysenteriae (MIC = 12.5 g/mL), Salmonella typhimurium (MIC = 50 g/mL), Klebsiella pneumoniae (MIC = 18.8 g/mL), Pseudomonas aeruginosa (MIC = 12.5 g/mL)." [Ref.30361948] It has 1.5% hemolysis against human red blood cells at 25 M and 3.0% hemolysis at 50 M.##[Ref.28547390] 3.3% hemolysis against human red blood cells at 25 M and 7.9% hemolysis t 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948##28547390 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25.##Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim. ##Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides.##Mono-substitution effects on antimicrobial activity of stapled heptapeptides. Stapled AMP DRAMP21559 R?WKJ?K RXWKJXK / 7 RKK No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 6.3 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC= 12.5 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysenteriae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 25 M), Klebsiella pneumoniae ATCC 10031 (MIC = 12.5 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)" [Ref.30361948] It has 1.5% hemolysis against human red blood cells at 25 M and 4.3% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21560 K?WRJ?K KXWRJXK / 7 KRK No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC= 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysenteriae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 75 M), Klebsiella pneumoniae ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)" [Ref.30361948] It has <1% hemolysis against human red blood cells at 25 M and 2.0% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21561 K?WKJ?R KXWKJXR / 7 KKR No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 9.4 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC = 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysenteriae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumoniae ATCC 10031 (MIC = 12.5 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)" [Ref.30361948] It has 1.4% hemolysis against human red blood cells at 25 M and % hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21562 R?WRJ?K RXWRJXK / 7 RRK No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC = 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysenteriae ATCC 9752 (MIC = 37.5 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumoniae ATCC 10031 (MIC = 50 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 37.5 M)" [Ref.30361948] It has <1% hemolysis against human red blood cells at 25 M and <1% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21563 R?WKJ?R RXWKJXR / 7 RKR No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 6.3 M), Staphyolococcus aureus ATCC 6538p (MIC = 3.2 M), Staphylococcus epidermidis ATCC 12228 (MIC = 12.5 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 6.3 M), Shigella dysenteriae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 25 M), Klebsiella pneumoniae ATCC 10031 (MIC = 18.8 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)" [Ref.30361948] It has 8.2% hemolysis against human red blood cells at 25 M and 17.0% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21564 K?WRJ?R KXWRJXR / 7 KRR No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 6.3 M), Staphyolococcus aureus ATCC 6538p (MIC = 3.2 M), Staphylococcus epidermidis ATCC 12228 (MIC = 12.5 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysenteriae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumoniae ATCC 10031 (MIC = 18.8 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 37.5 M)" [Ref.30361948] It has 1.8% hemolysis against human red blood cells at 25 M and 5.6% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21565 R?WRJ?R RXWRJXR / 7 RRR No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate solution (pH 6.5). "All analogs displayed similar CD spectra to that of KKK, having two minima near 208 and 222 nm and a maximum near 190nm, which are characteristic of -helices." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.30361948] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphyolococcus aureus ATCC 6538p (MIC = 6.3 M), Staphylococcus epidermidis ATCC 12228 (MIC = 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysenteriae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumoniae ATCC 10031 (MIC = 50 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 100 M)" [Ref.30361948] It has <1% hemolysis against human red blood cells at 25 M and 3.2% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The J (position: 5) in sequence is norleucine. The ? (position: 2 and 6) indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 30361948 Arch Pharm Res. 2018 Nov;41(11):1092-1097. doi: 10.1007/s12272-018-1084-5. Epub 2018 Oct 25. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Effects of lysine-to-arginine substitution on antimicrobial activity of cationic stapled heptapeptides Stapled AMP DRAMP21566 IDWKK?LDA?KQIL IDWKKXLDAXKQIL IDWKKLLDAAKQIL 14 MP1S No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A 96.1% -helical content in a 25 mM potassium phosphate buffer solution at 20 "Helical contents of all stapled analogues were increased by more than a three-fold compared to their unmodified counterpart, MP1. MP1S appears to be the most helical among this panel of peptides, showing 96% helicity, which is 3.7-fold higher than that of MP1." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.29075946] Gram-positive bacteria: Bacillus subtilis (MIC = 1.6 g/mL), Staphylococcus aureus (MIC = 2.4 g/mL), Staphylococcus epidermidis (MIC > 100 g/mL);##Gram-negative bacteria: Escherichia coli (MIC > 100 g/mL), Shigella dysenteriae (MIC > 100 g/mL), Salmonella typhimurium (MIC > 100 g/mL), Klebsiella pneumoniae (MIC > 100 g/mL), Pseudomonas aeruginosa (MIC > 100 g/mL)" [Ref.29075946] It has 6.7% hemolysis against human red blood cells at 12.5 M and 12.3% hemolysis at 25 M. Cyclic (Stapled) Free Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 29075946 Arch Pharm Res. 2017 Dec;40(12):1414-1419. doi: 10.1007/s12272-017-0963-5. Epub 2017 Oct 26. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim " Antimicrobial activity and stability of stapled helices of polybia-MP1 Stapled AMP DRAMP21567 IDWKK?LNA?KQIL IDWKKXLNAXKQIL IDWKKLLDAAKQIL 14 MP1S-D8N No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 89.4% -helical content in a 25 mM potassium phosphate buffer solution at 20 "Helical contents of all stapled analogues were increased by more than a three-fold compared to their unmodified counterpart, MP1. MP1S-D8N and MP1S-Q12K showed slightly lower helical contents (89.4% and 81.8, respectively)." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.29075946] Gram-positive bacteria: Bacillus subtilis (MIC = 0.8 g/mL), Staphylococcus aureus (MIC = 0.8 g/mL), Staphylococcus epidermidis (MIC = 37.5 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 50 g/mL), Shigella dysenteriae (MIC = 100 g/mL), Salmonella typhimurium (MIC > 100 g/mL), Klebsiella pneumoniae (MIC = 37.5 g/mL), Pseudomonas aeruginosa (MIC 100 g/mL)" [Ref.29075946] It has 16.3% hemolysis against human red blood cells at 12.5 M and 37.8% hemolysis at 25 M. Cyclic (Stapled) Free Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 29075946 Arch Pharm Res. 2017 Dec;40(12):1414-1419. doi: 10.1007/s12272-017-0963-5. Epub 2017 Oct 26. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim " Antimicrobial activity and stability of stapled helices of polybia-MP1 Stapled AMP DRAMP21568 IDWKK?LDA?KKIL IDWKKXLDAXKKIL IDWKKLLDAAKQIL 14 MP1S-Q12K No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A 81.8% -helical content in a 25 mM potassium phosphate buffer solution at 20 "Helical contents of all stapled analogues were increased by more than a three-fold compared to their unmodified counterpart, MP1. MP1S-D8N and MP1S-Q12K showed slightly lower helical contents (89.4% and 81.8, respectively)." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.29075946] Gram-positive bacteria: Bacillus subtilis (MIC = 0.8 g/mL), Staphylococcus aureus (MIC = 1.2 g/mL), Staphylococcus epidermidis (MIC = 50 g/mL);##Gram-negative bacteria: Escherichia coli (MIC >100 g/mL), Shigella dysenteriae (MIC > 100 g/mL), Salmonella typhimurium (MIC > 100 g/mL), Klebsiella pneumoniae (MIC > 100 g/mL), Pseudomonas aeruginosa (MIC > 100 g/mL)" [Ref.29075946] It has 9.6% hemolysis against human red blood cells at 12.5 M and 13.9% hemolysis at 25 M. Cyclic (Stapled) Free Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 29075946 Arch Pharm Res. 2017 Dec;40(12):1414-1419. doi: 10.1007/s12272-017-0963-5. Epub 2017 Oct 26. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim " Antimicrobial activity and stability of stapled helices of polybia-MP1 Stapled AMP DRAMP21569 K?WKA?K KXWKAXK / 7 ALA No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 25 g/mL), Staphylococcus aureus (MIC = 25 g/mL), Staphylococcus epidermidis (MIC = 100 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 25 g/mL), Shigella dysenteriae (MIC = 50 g/mL), Salmonella typhimurium (MIC = 100 g/mL), Klebsiella pneumoniae (MIC = 25 g/mL), Pseudomonas aeruginosa (MIC = 25 g/mL)" [Ref.28547390] It has <1% hemolysis against human red blood cells at 25 M and <1% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21570 K?WKL?K KXWKLXK / 7 LEU No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 25 g/mL), Staphylococcus aureus (MIC = 12.5 g/mL), Staphylococcus epidermidis (MIC = 50 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 12.5 g/mL), Shigella dysenteriae (MIC = 25 g/mL), Salmonella typhimurium (MIC = 50 g/mL), Klebsiella pneumoniae (MIC = 18.8 g/mL), Pseudomonas aeruginosa (MIC = 18.8 g/mL)" [Ref.28547390] It has <1% hemolysis against human red blood cells at 25 M and <1% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21571 K?WKV?K KXWKVXK / 7 VAL No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "Compared to LEU, the previously reported stapled heptapeptide containing leucine in position 5, peptides VAL and ILE, carrying valine and isoleucine, respectively, appeared slightly more helical as determined by the CD signal intensity at 222 nm." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 18.8 g/mL), Staphylococcus aureus (MIC = 12.5 g/mL), Staphylococcus epidermidis (MIC = 50 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 18.8 g/mL), Shigella dysenteriae (MIC = 25 g/mL), Salmonella typhimurium (MIC = 100 g/mL), Klebsiella pneumoniae (MIC = 18.8 g/mL), Pseudomonas aeruginosa (MIC = 12.5 g/mL)" [Ref.28547390] It has 1.3% hemolysis against human red blood cells at 25 M and 2.5% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21572 K?WKI?K KXWKIXK / 7 ILE No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "Compared to LEU, the previously reported stapled heptapeptide containing leucine in position 5, peptides VAL and ILE, carrying valine and isoleucine, respectively, appeared slightly more helical as determined by the CD signal intensity at 222 nm." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 25 g/mL), Staphylococcus aureus (MIC = 25 g/mL), Staphylococcus epidermidis (MIC = 50 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 25 g/mL), Shigella dysenteriae (MIC = 25 g/mL), Salmonella typhimurium (MIC = 100 g/mL), Klebsiella pneumoniae (MIC = 37.5 g/mL), Pseudomonas aeruginosa (MIC = 12.5 g/mL)" [Ref.28547390] It has 1.5% hemolysis against human red blood cells at 25 M and 3.0% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21573 K?WKF?K KXWKFXK / 7 PHE No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "On the other hand, peptide PHE, TRP, and GLU, bearing phenylalanine, tryptophan, and glutamate, respectively, showed a slightly decreased helicity." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 25 g/mL), Staphylococcus aureus (MIC = 25 g/mL), Staphylococcus epidermidis (MIC = 50 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 25 g/mL), Shigella dysenteriae (MIC = 50 g/mL), Salmonella typhimurium (MIC = 100 g/mL), Klebsiella pneumoniae (MIC = 25 g/mL), Pseudomonas aeruginosa (MIC = 12.5 g/mL)" [Ref.28547390] It has 1.9% hemolysis against human red blood cells at 25 M and 4.4% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21574 K?WKW?K KXWKWXK / 7 TRP No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "On the other hand, peptide PHE, TRP, and GLU, bearing phenylalanine, tryptophan, and glutamate, respectively, showed a slightly decreased helicity." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 12.5 g/mL), Staphylococcus aureus (MIC = 12.5 g/mL), Staphylococcus epidermidis (MIC = 25 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 12.5 g/mL), Shigella dysenteriae (MIC = 25 g/mL), Salmonella typhimurium (MIC = 50 g/mL), Klebsiella pneumoniae (MIC = 12.5 g/mL), Pseudomonas aeruginosa (MIC = 12.5 g/mL)" [Ref.28547390] It has 3.2% hemolysis against human red blood cells at 25 M and 5.9% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21575 K?WKE?K KXWKEXK / 7 GLU No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "On the other hand, peptide PHE, TRP, and GLU, bearing phenylalanine, tryptophan, and glutamate, respectively, showed a slightly decreased helicity." Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 100 g/mL. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC > 100 g/mL), Staphylococcus aureus (MIC > 100 g/mL), Staphylococcus epidermidis (MIC > 100 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 37.5 g/mL), Shigella dysenteriae (MIC > 100 g/mL), Salmonella typhimurium (MIC > 100 g/mL), Klebsiella pneumoniae (MIC = 50 g/mL), Pseudomonas aeruginosa (MIC = 25 g/mL)" [Ref.28547390] It has <1% hemolysis against human red blood cells at 25 M and <1% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21576 K?WKK?K KXWKKXK / 7 LYS No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 Peptide NLE and LYS maintained a compatible helicity to LEU. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28547390] Gram-positive bacteria: Bacillus subtilis (MIC = 100 g/mL), Staphylococcus aureus (MIC = 50 g/mL), Staphylococcus epidermidis (MIC > 100 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 50 g/mL), Shigella dysenteriae (MIC = 100 g/mL), Salmonella typhimurium (MIC > 100 g/mL), Klebsiella pneumoniae (MIC = 75 g/mL), Pseudomonas aeruginosa (MIC = 6.3 g/mL)" [Ref.28547390] It has <1% hemolysis against human red blood cells at 25 M and <1% hemolysis at 50 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 28547390 Arch Pharm Res. 2017 Jun;40(6):713-719. doi: 10.1007/s12272-017-0922-1. Epub 2017 May 25. "Huy X Luong, Do-Hee Kim, Ngoan T Mai, Bong-Jin Lee, Young-Woo Kim" Mono-substitution effects on antimicrobial activity of stapled heptapeptides Stapled AMP DRAMP21578 WWV?ARA?RR WWVXARAXRR WWVXARAXRR 10 Val-HSLP No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 0.0% -helix and 34.3% -strand in 20 mM potassium phosphate buffer; 0.8% -helix and 36.9% -strand in 20 mM potassium phosphate buffer made 30% in TFE. "Only slghtly higher -strand characteristics were observed for the hydrocarbon-stapled peptides in 30% TFE. Overall, the peptides showed some -strand secondary structural characteristics and little -helical content." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. Antifungal activity against Candida albicans is not noteable under 20 M. "[Ref.28073163] Gram-positive bacteria: Bacillus megaterium ATCC 14581 (IC50 = 0.69 M, MIC = 5.00 M), Staphylococcus aureus ATCC 6538 (IC50 = 0.63 M, MIC = 5.00 M), Enterococcus faecalis ATCC 29212 (IC50 = 0.65 M, MIC = 5.00 M);##Gram-negative bacteria: Escherichia coli ATCC 700926 (IC50 = 14.8 M, MIC > 20 M);## Fungi: Candida albicans 002 ATCC 64385 (IC50 > 20 M, MIC > 20 M), C. albicans 004 ATCC MYA-2876 (IC50 > 20 M, MIC > 20 M)." [Ref.28073163] HC50 = 14.5 M against human red blood cells. Note: HC50 is the half-maximal hemolytic concentration. Cyclic (Stapled) Acylation (Valerylamide) Amidation The ? (position: 4 and 8) in sequence indicates (S)-2-(4'-pentenyl)-alanine. ? (4) and ? (8) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 28073163 Biopolymers. 2017 May;108(3). doi: 10.1002/bip.23006. "Zachary B Jenner, Christopher M Crittenden, Martn Gonzalez, Jennifer S Brodbelt, Kerry A Bruns" Hydrocarbon-stapled lipopeptides exhibit selective antimicrobial activity Stapled AMP DRAMP21580 WWV?AFA?RRR WWVXAFAXRRR WWVXAFAXRRR 11 Cap-HSLP No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A 0.3% -helix and 31.9% -strand in 20 mM potassium phosphate buffer; 0.7% -helix and 40.0% -strand in 20 mM potassium phosphate buffer made 30% in TFE. "Only slghtly higher -strand characteristics were observed for the hydrocarbon-stapled peptides in 30% TFE. Overall, the peptides showed some -strand secondary structural characteristics and little -helical content." Not found Function: Antibacterial activity against Gram-positive bacteria. Antibacterial activity against Gram-negative bacteria and antifungal activity against Candida albicans are not noteable under 20 M. "[Ref.28073163] Gram-positive bacteria: Bacillus megaterium ATCC 14581 (IC50 = 1.63 M, MIC = 5.00 M), Staphylococcus aureus ATCC 6538 (IC50 = 0.64 M, MIC = 5.00 M), Enterococcus faecalis ATCC 29212 (IC50 = 0.63 M, MIC = 1.25 M);##Gram-negative bacteria: Escherichia coli ATCC 700926 (IC50 = 169 M, MIC > 20 M);## Fungi: Candida albicans 002 ATCC 64385 (IC50 > 20 M, MIC > 20 M), C. albicans 004 ATCC MYA-2876 (IC50 > 20 M, MIC > 20 M)." [Ref.28073163] HC50 = 4.49 M against human red blood cells. Note: HC50 is the half-maximal hemolytic concentration. Cyclic (Stapled) Acylation (Caproylamide) Amidation The ? (position: 4 and 8) in sequence indicates (S)-2-(4'-pentenyl)-alanine. ? (4) and ? (8) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 28073163 Biopolymers. 2017 May;108(3). doi: 10.1002/bip.23006. "Zachary B Jenner, Christopher M Crittenden, Martn Gonzalez, Jennifer S Brodbelt, Kerry A Bruns" Hydrocarbon-stapled lipopeptides exhibit selective antimicrobial activity Stapled AMP DRAMP21582 K?WKL?K KXWKLXK / 7 S3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A Stable -helix in a 25 mM potassium phosphate buffer solution at 20 No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 25 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 100 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 g/mL), Shigella dysentariae ATCC 9752 (MIC = 50 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 100 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 50 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 75 g/mL)" It has <1% hemolysis against human red blood cells at 6.3 M and <1% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21583 K?WKL?KGK?WKL?K KXWKLXKGKXWKLXK / 15 3GL3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 3GL3 apperaed to be the most helical in this series as indicated by the distinct double minima near at 208 and 222 nm with similar intensities. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 2.3 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 1.6 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 3.1 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.1 g/mL), Shigella dysentariae ATCC 9752 (MIC = 37.5 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 50 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 6.3 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 9.4 g/mL)" It has 19.1% hemolysis against human red blood cells at 6.3 M and 31.8% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2, 6, 10 and 14) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (10) and ? (14) are cross-linked respectively by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21584 K?WKL?KAK?WKL?K KXWKLXKAKXWKLXK / 15 3BA3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "No specific results about the strcture presented in the forms of tables, graphs or words" No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 2.3 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 1.6 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 3.1 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.1 g/mL), Shigella dysentariae ATCC 9752 (MIC = 6.3 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 12.5 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 3.1 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 3.1 g/mL)" It has 14.2% hemolysis against human red blood cells at 6.3 M and 24.9% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The A (position: 8) in sequence is -Ala. The ? (position: 2, 6, 10 and 14) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (10) and ? (14) are cross-linked respectively by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21585 K?WKL?KBK?WKL?K KXWKLXKBKXWKLXK / 15 3GA3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "No specific results about the strcture presented in the forms of tables, graphs or words" No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 4.0 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 3.1 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 12.5 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 4.7 g/mL), Shigella dysentariae ATCC 9752 (MIC = 18.8 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 37.5 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 9.4 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 9.4 g/mL)" It has 12.9% hemolysis against human red blood cells at 6.3 M and 24.4% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The B (position: 8) in sequence is -aminobutyric acid (GABA). The ? (position: 2, 6, 10 and 14) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (10) and ? (14) are cross-linked respectively by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21586 K?WKL?KPK?WKL?K KXWKLXKPKXWKLXK / 15 3PR3-X No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "Whereas all other dimeric analogs were obtained as a single exclusive product, the proline-containing sequence yielded two products (3PR3-X and 3PR3-Y) in similar amounts. These might be conformational isomers induced by the cisCtrans configuration of the proline linker. 3PR3-X, which showed the weakest hemolytic activity, displayed a CD spectrum similar to that of the monomeric S3 and the lowest helical content in this series." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 3.1 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 4.7 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 12.5 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.1 g/mL), Shigella dysentariae ATCC 9752 (MIC = 6.3 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 12.5 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 4.7 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 9.4 g/mL)" It has 5.7% hemolysis against human red blood cells at 6.3 M and 9.7% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2, 6, 10 and 14) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (10) and ? (14) are cross-linked respectively by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. " L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21587 K?WKL?KPK?WKL?K KXWKLXKPKXWKLXK / 15 3PR3-Y No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution at 20 "Whereas all other dimeric analogs were obtained as a single exclusive product, the proline-containing sequence yielded two products (3PR3-X and 3PR3-Y) in similar amounts. These might be conformational isomers induced by the cisCtrans configuration of the proline linker." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.2 g/mL), Staphylcocccus aureus ATCC 6538p (MIC = 1.2 g/mL), Staphylcococcus epidermis ATCC 12228 (MIC = 4.7 g/mL);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 2.3 g/mL), Shigella dysentariae ATCC 9752 (MIC = 4.7 g/mL), Salmonella typhimurium ATCC 14028 (MIC = 12.5 g/mL), Klebsiella pneumonia ATCC 10031 (MIC = 3.1 g/mL), Pseudomonas aeruginosa ATCC 27853 (MIC = 6.3 g/mL)" It has 16.2% hemolysis against human red blood cells at 6.3 M and 31.9% hemolysis at 12.5 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2, 6, 10 and 14) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (10) and ? (14) are cross-linked respectively by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. The P (position: 8) in sequence is D-proline." Mixed (D-Pro8) No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2016 Aug;37(8)1199-1203. doi: 10.1002/bkcs.10839. "Huy X Luong, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers Stapled AMP DRAMP21588 K?WKA?K KXWKAXK / 7 Ac-S1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) "On the contraty, conformations of sequences S1 and S3 appear to be not greatly affected by the presence of the N-acetyl cap." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 25 M), Staphylcocccus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 37.5 M), Shigella dysentariae ATCC 9752 (MIC = 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 50 M), Pseudomonas aeruginose ATCC 27853 (MIC = 50 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and <1.0% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21589 K?WKA?K KXWKAXK / 7 H-S1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) "On the contraty, conformations of sequences S1 and S3 appear to be not greatly affected by the presence of the N-acetyl cap." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 37.5 M), Staphylcocccus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 100 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 25 M), Pseudomonas aeruginose ATCC 27853 (MIC = 25 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and <1.0% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21590 K?AKW?K KXAKWXK / 7 Ac-S2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) Conformational analysis using far ultraviolet CD spectrometry indicates that the removal of the N-acetyl cap from Ac-S2 and Ac-S4 causes a significant loss of their helical contents. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 37.5 M), Staphylcocccus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginose ATCC 27853 (MIC = 50 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and <1.0% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21591 K?AKW?K KXAKWXK / 7 H-S2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix (but less helical than Ac-S2) in a 25 mM potassium phosphate buffer solution (pH 6.5) Conformational analysis using far ultraviolet CD spectrometry indicates that the removal of the N-acetyl cap from Ac-S2 and Ac-S4 causes a significant loss of their helical contents. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 37.5 M), Staphylococcus aureus ATCC 6538p (MIC = 37.5 M), Staphylcocccus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 50 M), Shigella dysentariae ATCC 9752 (MIC > 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 50 M), Pseudomonas aeruginose ATCC 27853 (MIC = 37.5 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and <1.0% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21592 K?WKL?K KXWKLXK / 7 Ac-S3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) "On the contraty, conformations of sequences S1 and S3 appear to be not greatly affected by the presence of the N-acetyl cap." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 18.8 M), Staphylococcus aureus ATCC 6538p (MIC = 25 M), Staphylcocccus epidermis ATCC 12228 (MIC = 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 75 M), Klebsiella pneumonia ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginose ATCC 27853 (MIC = 50 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, 1.59% and 5.53% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21593 K?WKL?K KXWKLXK / 7 H-S3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) "On the contraty, conformations of sequences S1 and S3 appear to be not greatly affected by the presence of the N-acetyl cap. It should be also noted that H-S3 displays a CD spectrum that is typically observed from -helical peptides even without the N-acetyl cal." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphylococcus aureus ATCC 6538p (MIC = 12.5 M), Staphylcocccus epidermis ATCC 12228 (MIC = 25 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumonia ATCC 10031 (MIC = 25 M), Pseudomonas aeruginose ATCC 27853 (MIC = 25 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and 2.05% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21594 K?LKW?K KXLKWXK / 7 Ac-S4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in a 25 mM potassium phosphate buffer solution (pH 6.5) Conformational analysis using far ultraviolet CD spectrometry indicates that the removal of the N-acetyl cap from Ac-S2 and Ac-S4 causes a significant loss of their helical contents. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphylococcus aureus ATCC 6538p (MIC = 25 M), Staphylcocccus epidermis ATCC 12228 (MIC = 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginose ATCC 27853 (MIC = 50 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, 1.29%, 2.84% and 5.74% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21595 K?LKW?K KXLKWXK / 7 H-S4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix (but less helix content Ac-S4) in a 25 mM potassium phosphate buffer solution (pH 6.5) Conformational analysis using far ultraviolet CD spectrometry indicates that the removal of the N-acetyl cap from Ac-S2 and Ac-S4 causes a significant loss of their helical contents. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 50 M), Staphylcocccus epidermis ATCC 12228 (MIC = 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 75 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginose ATCC 27853 (MIC = 25 M)" "It has <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0%, <1.0% and <1.0% hemolysis against human red blood cells at 0.8,1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Free Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pententylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC. 2015 Oct;36(10)2511-2515. doi: 10.1002/bkcs.10483. "Thuy T.T. Dinh, Do-Hee Kim, Thang Q. Nguyen, Bong-Jin Lee, Young-Woo Kim" N-Capping Effects of Stapled Heptapeptides on Antimicrobial and Hemolytic Activities Stapled AMP DRAMP21597 K?AKA?KKAAKAAWK KXAKAXKKAAKAAWK KAAKAAKKAAKAAWK 15 Ac-SS-14W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH6.5) "On the other hand, singly-stapled analog Ac-SS-14W exhibited a typical CD spectrum for -helix, characterized by two minima near 208 and 222 nm and a maximum near 190 nm. " Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 9.4 M), Staphylococcus epidermis ATCC 12228 (MIC = 75 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.1 M), Shigella dysentariae ATCC 9752 (MIC = 18.8 M), Salmonella typhimurium ATCC 14028 (MIC > 200 M), Klebsiella pneumonia ATCC 10031 (MIC = 18.8 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 100 M)." [Ref.26235946] It has <1% hemolysis against human red blood cells at 12.5 M and <1% hemolysis at 25 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21598 K?AKA?KK?AKA?WK KXAKAXKKXAKAXWK KAAKAAKKAAKAAWK 15 Ac-DS-14W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH6.5) Doubly-stapled Ac-Ds-14W showed the most enhaced helical contents among this series of peptides. Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.6 M), Staphylococcus aureus ATCC 6538p (MIC = 4.8 M), Staphylococcus epidermis ATCC 12228 (MIC = 3.1 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 200 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 100 M)." [Ref.26235946] It has 22.1% hemolysis against human red blood cells at 12.5 M and 38.8% hemolysis at 25 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21599 K?AKA?KK?AKW?AK KXAKAXKKXAKWXAK KAAKAAKKAAKAAWK 15 Ac-DS-12W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "In addition, the positional modification of tryptophan caused significant changes in the conformation: in the CD analysis, the most active Ac-DS-5W exhibited markedly enhanced helical content whereas the equipotent Ac-DS-12W showed decreased helicity compared to Ac-DS-14W" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.6 M), Staphylococcus aureus ATCC 6538p (MIC = 3.1 M), Staphylococcus epidermis ATCC 12228 (MIC = 4.8 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 50 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 200 M), Klebsiella pneumonia ATCC 10031 (MIC = 100 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 100 M)." [Ref.26235946] It has 25.3% hemolysis against human red blood cells at 12.5 M and 42.5% hemolysis at 25 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21600 K?AKW?KK?AKA?AK KXAKWXKKXAKAXAK KAAKAAKKAAKAAWK 15 Ac-DS-3W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) No other descriptive information about the structure found in the literature Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 3.1 M), Staphylococcus aureus ATCC 6538p (MIC = 4.8 M), Staphylococcus epidermis ATCC 12228 (MIC = 4.8 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC = 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 100 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 200 M)." [Ref.26235946] It has 28.9% hemolysis against human red blood cells at 12.5 M and 42.5% hemolysis at 25 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21601 K?WKA?KK?AKA?AK KXWKAXKKXAKAXAK KAAKAAKKAAKAAWK 15 Ac-DS-5W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "In addition, the positional modification of tryptophan caused significant changes in the conformation: in the CD analysis, the most active Ac-DS-5W exhibited markedly enhanced helical content whereas the equipotent Ac-DS-12W showed decreased helicity compared to Ac-DS-14W" Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.6 M), Staphylococcus aureus ATCC 6538p (MIC = 1.6 M), Staphylococcus epidermis ATCC 12228 (MIC = 1.6 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 18.8 M), Shigella dysentariae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 37.5 M), Klebsiella pneumonia ATCC 10031 (MIC = 37.5 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)." [Ref.26235946] It has 22.0% hemolysis against human red blood cells at 12.5 M and 38.5% hemolysis at 25 M. Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21602 K?AKW?KK?AKA?AK KXAKWXKKXAKAXAK KAAKAAKKAAKAAWK 15 Su-DS-5W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "In the CD experiments, these new analogs showed similar helicity to Ac-DS-5W although Su-DS-5W displayed a slight increase in helicity whereas H-DS-5W exhibited a slight decrease." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.6 M), Staphylococcus aureus ATCC 6538p (MIC = 1.6 M), Staphylococcus epidermis ATCC 12228 (MIC = 1.6 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysentariae ATCC 9752 (MIC = 50 M), Salmonella typhimurium ATCC 14028 (MIC > 200 M), Klebsiella pneumonia ATCC 10031 (MIC = 25 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 50 M)." [Ref.26235946] It has 19.5% hemolysis against human red blood cells at 12.5 M and 32.6% hemolysis at 25 M. Cyclic (Stapled) Succinylation Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21603 K?AKW?KK?AKA?AK KXAKWXKKXAKAXAK KAAKAAKKAAKAAWK 15 H-DS-5W No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "In the CD experiments, these new analogs showed similar helicity to Ac-DS-5W although Su-DS-5W displayed a slight increase in helicity whereas H-DS-5W exhibited a slight decrease." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.26235946] Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 1.6 M), Staphylococcus aureus ATCC 6538p (MIC = 1.6 M), Staphylococcus epidermis ATCC 12228 (MIC = 1.6 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 3.1 M), Shigella dysentariae ATCC 9752 (MIC = 12.5 M), Salmonella typhimurium ATCC 14028 (MIC = 6.3 M), Klebsiella pneumonia ATCC 10031 (MIC = 12.5 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 6.3 M)." [Ref.26235946] It has 13.5% hemolysis against human red blood cells at 12.5 M and 25.5% hemolysis at 25 M. Cyclic (Stapled) Free Amidation "The ? (position: 2 ,6, 9 and 13) in sequence indicates (S)--methyl, -pentenylglycine. ? (2) and ? (6), ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found in the reference 26235946 Bioorg Med Chem Lett. 2015 Sep 15;25(18):4016-9. doi: 10.1016/j.bmcl.2015.06.053. Epub 2015 Jun 19. "Thuy T T Dinh, Do-Hee Kim, Huy X Luong, Bong-Jin Lee, Young-Woo Kim" Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Stapled AMP DRAMP21605 K?WKA?K KXWKAXK KXWKAXK 7 S1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 25 M), Staphylococcus aureus ATCC 6538p (MIC = 25 M), Staphylococcus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 50 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 50 M)." "It has 0.53%, 0.53%, 0.67%, 0.66%, 0.83%, 1.36%, 1.17% and 1.21% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21607 K?AKW?K KXAKWXK KXAKWXK 7 S2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 50 M), Staphylococcus aureus ATCC 6538p (MIC = 100 M), Staphylococcus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 50 M), Shigella dysentariae ATCC 9752 (MIC > 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 100 M), Pseudomonas aeruginosa ATCC 27853 (MIC > 100 M)." "It has 0.91%, 1.01%, 0.66%, 0.99%, 0.63%, 0.82%, 1.75% and 1.24% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21609 K?WKL?K KXWKLXK KXWKLXK 7 S3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphylococcus aureus ATCC 6538p (MIC = 25 M), Staphylococcus epidermis ATCC 12228 (MIC = 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 12.5 M), Shigella dysentariae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumonia ATCC 10031 (MIC = 25 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)." "It has 0.87%, 0.65%, 1.02%, 0.94%, 2.13%, 2.52%, 3.81% and 7.75% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21611 K?LKW?K KXLKWXK KXLKWXK 7 S4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 12.5 M), Staphylococcus aureus ATCC 6538p (MIC = 12.5 M), Staphylococcus epidermis ATCC 12228 (MIC = 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 25 M), Shigella dysentariae ATCC 9752 (MIC = 25 M), Salmonella typhimurium ATCC 14028 (MIC = 50 M), Klebsiella pneumonia ATCC 10031 (MIC = 25 M), Pseudomonas aeruginosa ATCC 27853 (MIC = 25 M)." "It has 0.71%, 0.90%, 0.71%, 0.68%, 1.08%, 1.87%, 2.46% and 4.50% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21613 K?WAK?A KXWAKXA KXWAKXA 7 S5 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC = 50 M), Staphylococcus aureus ATCC 6538p (MIC = 50 M), Staphylococcus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 50 M), Shigella dysentariae ATCC 9752 (MIC > 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC = 100 M), Pseudomonas aeruginosa ATCC 27853 (MIC > 100 M)." "It has 0.65%, 0.60%, 0.59%, 0.76%, 0.83%, 0.76%, 0.88% and 1.04% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21615 K?AWK?A KXAWKXA KXAWKXA 7 S6 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in 25 mM potassium phosphate buffer solution (pH 6.5) "As expected, in the far ultraviolet circular dichroism (CD) experiment, the stapled heptapeptides displayed enhanced helical contents compared to their corresponding unstapled counterparts." Not found Function: Antibacterial activity against Gram-negative bacteria. Antibacterial activity against Gram-positive bacteria is not noteable under 100 M. "Gram-positive bacteria: Bacillus subtilis ATCC 6633 (MIC > 100 M), Staphylococcus aureus ATCC 6538p (MIC > 100 M), Staphylococcus epidermis ATCC 12228 (MIC > 100 M);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC = 100 M), Shigella dysentariae ATCC 9752 (MIC > 100 M), Salmonella typhimurium ATCC 14028 (MIC > 100 M), Klebsiella pneumonia ATCC 10031 (MIC > 100 M), Pseudomonas aeruginosa ATCC 27853 (MIC > 100 M)." "It has 0.65%, 0.66%, 0.75%, 0.87%, 0.64%, 0.70%, 0.61% and 0.84% hemolysis against human red blood cells at 0.8, 1.6, 3.1, 6.3, 12.5, 25.0, 50.0 and 100.0 M." Cyclic (Stapled) Acetylation Amidation "The ? (position: 2 and 6) in sequence indicates (S)--methyl, -pentenylglycine. Note: the Experimental section presenst that X is (S)--methyl, -pentenylglycine, while the Results section presents that X is pentenylalanine. We incline to the former representation according to previous papers published by the research group which the author belonged. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple." L No cytotoxicity information found. PubMed ID is not available B KOREAN CHEM SOC "Thuy T.T. Dinh, Do-Hee Kim, Song-Jin Lee, Young-Woo Kim" De Novo Design and Their Antimicrobial Activity of Stapled Amphipathic Helices of Heptapeptides Stapled AMP DRAMP21617 qqrkrkiws?lap?gttlvklvagig qqrkrkiwsklapdgttlvklvagig qqrkrkiwsilaplgttlvklvagig 26 sDRIM No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "Disordered (or unstructured) conformation in aqueous solutions [pure water (H?O), phosphate buffer (PB, 10 mM), and phosphate buffer with high salt (NaF, 100 mM)]. 50% average -helix content in various membranes environments [57% in POPC; 67% in POPC/P" "In the cases of sDRIM and sKFGF, stapling did not induce any conformational change, as these analogues remained just as unstructured." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28921993] Gram-positive bacteria: Staphylococcus aureus (MIC = 128 g/mL), Enterococcus faecalis (MIC = 64 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 32 g/mL), Pseudomonas aeruginosa (MIC = 64 g/mL)" "[Ref.28921993] It has 13.4%, 18.6%, 25.4%, 33.4%, 42.0%, 46.9%, 42.2% and 47.1% hemolysis against human red blood cells at 5, 7.5, 10, 15, 20, 25, 30 and 40 g/ml." Cyclic (Stapled) Free Amidation ? (10) and ? (14) are corss-linked by lactam stapling through the polar amide bond of a lactam bridge. D [Ref.28921993] The toxicity of sDRIM toward HEK293 and HeLa cells is much less than nonaarginine (R9) by use of flow cytometry and the peptide doesn't show any cytotoxicity at 2 M. 28921993 J Med Chem. 2017 Oct 12;60(19):8071-8082. doi: 10.1021/acs.jmedchem.7b00813. Epub 2017 Sep 26. "Marco J Klein, Samuel Schmidt, Parvesh Wadhwani, Jochen Brck, Johannes Reichert, Sergii Afonin, Marina Berditsch, Tim Schober, Roland Brock, Manfred Kansy, Anne S Ulrich" Lactam-Stapled Cell-Penetrating Peptides: Cell Uptake and Membrane Binding Properties. Stapled AMP DRAMP21619 PLI?LRL?RGQF PLIKLRLDRGQF PLILLRLLRGQF 12 sWWSP No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "٦-helix in aqueous solutions [pure water (H?O), phosphate buffer (PB, 10 mM), and phosphate buffer with high salt (NaF, 100 mM)]. 43% average -helix content in various membranes environments [38% in POPC; 58% in POPC/POPG(3:1); 47% in POPC:lysoPC(9:1);" "On the other hand, sWWSP and sMAP-1 assumed an -helical conformation in aqueous solution, in contrast to their unstructured linear countparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28921993] Gram-positive bacteria: Staphylococcus aureus (MIC > 256 g/mL), Enterococcus faecalis (MIC > 256 g/mL);##Gram-negative bacteria: Escherichia coli (MIC > 256 g/mL), Pseudomonas aeruginosa (MIC > 256 g/mL)" "[Ref.28921993] It has 4.0%, 4.8%, 4.6%, 4.2% and 7.0% hemolysis against human red blood cells at 15, 20, 25, 30 and 40 g/ml." Cyclic (Stapled) Free Amidation ? (4) and ? (8) are cross-linked by lactam stapling through the polar amide bond of a lactam bridge. L [Ref.28921993] The toxicity of sWWSP toward HEK293 and HeLa cells is much less than nonaarginine (R9) by use of flow cytometry and the peptide doesn't show any cytotoxicity at 2 M. 28921993 J Med Chem. 2017 Oct 12;60(19):8071-8082. doi: 10.1021/acs.jmedchem.7b00813. Epub 2017 Sep 26. "Marco J Klein, Samuel Schmidt, Parvesh Wadhwani, Jochen Brck, Johannes Reichert, Sergii Afonin, Marina Berditsch, Tim Schober, Roland Brock, Manfred Kansy, Anne S Ulrich" Lactam-Stapled Cell-Penetrating Peptides: Cell Uptake and Membrane Binding Properties. Stapled AMP DRAMP21621 AA?LLP?LLAAP AAKLLPDLLAAP AAVLLPVLLAAP 12 sKFGF No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "Disordered (or unstructured) conformation in aqueous solutions [pure water (H?O), phosphate buffer (PB, 10 mM), and phosphate buffer with high salt (NaF, 100 mM)]. Around 22% average -helix content in various membranes environments [13% in POPC; 32% in" "In the cases of sDRIM and sKFGF, stapling did not induce any conformational change, as these analogues remained just as unstructured." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28921993] Gram-positive bacteria: Staphylococcus aureus (MIC > 256 g/mL), Enterococcus faecalis (MIC > 256 g/mL);##Gram-negative bacteria: Escherichia coli (MIC > 256 g/mL), Pseudomonas aeruginosa (MIC > 256 g/mL)" "[Ref.28921993] It has 0.4%, 0%, 0.1%, 0.2%, 0.1%, 0.7%, 1.8% and 5.6% hemolysis against human red blood cells at 5, 7.5, 10, 15, 20, 25, 30 and 40 g/ml." Cyclic (Stapled) Free Amidation ? (3) and ? (7) are cross-linked by lactam stapling through the polar amide bond of a lactam bridge. L [Ref.28921993] The toxicity of sKFGF toward HEK293 and HeLa cells is much less than nonaarginine (R9) by use of flow cytometry and the peptide doesn't show any cytotoxicity at 2 M. 28921993 J Med Chem. 2017 Oct 12;60(19):8071-8082. doi: 10.1021/acs.jmedchem.7b00813. Epub 2017 Sep 26. "Marco J Klein, Samuel Schmidt, Parvesh Wadhwani, Jochen Brck, Johannes Reichert, Sergii Afonin, Marina Berditsch, Tim Schober, Roland Brock, Manfred Kansy, Anne S Ulrich" Lactam-Stapled Cell-Penetrating Peptides: Cell Uptake and Membrane Binding Properties. Stapled AMP DRAMP21623 KLALKALK?LKA?LKLA KLALKALKKLKADLKLA KLALKALKALKAALKLA 17 sMAP-1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "٦-helix in aqueous solutions [pure water (H?O), phosphate buffer (PB, 10 mM), and phosphate buffer with high salt (NaF, 100 mM)]. 46% average -helix content in various membranes environments [37% in POPC; 59% in POPC/POPG(3:1); 45% in POPC:lysoPC(9:1);" "On the other hand, sWWSP and sMAP-1 assumed an -helical conformation in aqueous solution, in contrast to their unstructured linear countparts." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.28921993] Gram-positive bacteria: Staphylococcus aureus (MIC = 64 g/mL), Enterococcus faecalis (MIC > 256 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 256 g/mL), Pseudomonas aeruginosa (MIC > 256 g/mL)" "[Ref.28921993] It has 2.5%, 2.9%, 2.4%, 4.1%, 2.9%, 6.3%, 4.9% and 8.2% hemolysis against human red blood cells at 5, 7.5, 10, 15, 20, 25, 30 and 40 g/ml." Cyclic (Stapled) Free Amidation ? (9) and ? (13) are cross-linked by lactam stapling through the polar amide bond of a lactam bridge. L [Ref.28921993] The toxicity of sMAP-1 toward HEK293 and HeLa cells is much less than nonaarginine (R9) by use of flow cytometry and the peptide doesn't show any cytotoxicity at 2 M. 28921993 J Med Chem. 2017 Oct 12;60(19):8071-8082. doi: 10.1021/acs.jmedchem.7b00813. Epub 2017 Sep 26. "Marco J Klein, Samuel Schmidt, Parvesh Wadhwani, Jochen Brck, Johannes Reichert, Sergii Afonin, Marina Berditsch, Tim Schober, Roland Brock, Manfred Kansy, Anne S Ulrich" Lactam-Stapled Cell-Penetrating Peptides: Cell Uptake and Membrane Binding Properties. Stapled AMP DRAMP21624 ?LAA?RH? XLAAJRHX ELAAIRHR 8 V30-SP-8 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A "26.1% -helix content in 50 M aqueous solution [a mixture of water and acetonitrile (9:1, v/v)]." "The helical propensities of two stapled peptides, V30-SP-8 and V30-SP-9, and their linear counterparts were analyzed via circular dichroism (CD) spectrometry. Surprisingly, in contrast to our expectation that the stitched peptide, V30-SP-8, would be more helical than the monostapled peptide, V30-SP-9, the monostapling strategy was more effective in inducing helicity (helicity: 26.1% for V30-SP-8 and 33.8% for V30-SP-9)" Not found Function: Antibacterial activity against Gram-positive bacteria. The peptide shows a similar potency to vancomycin (MIC50 = 20 M against M.smegmatis) "[Ref.32840352] Gram-positive bacteria: Mycobacterium smegmatis (The antibacterial effects of V30-SP-8 are 36.9%, 42.7%, 50.9% and 55.4% at 6.25, 12.5, 25 and 50 M, and MIC50 is between 12.5 M and 25.0 M)" [Ref.32840352] No hemolytic activity information found. Cyclic (Stapled) Free Free "The ? (position: 1 and 8) in sequence indicates S5 stapling amino acid. Note: S5 is (S)-pentenyl alanine. The ? (position: 5) in sequence is B5 stapling amino acid. Note: B5 is -dipentenyl alanine. ? (1) and ? (5), ? (5) and ? (8) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple respectively." L No cytotoxicity information found in the reference 32840352 ACS Chem Biol. 2020 Sep 18;15(9):2493-2498. doi: 10.1021/acschembio.0c00492. Epub 2020 Sep 9. "Sung-Min Kang, Heejo Moon, Sang-Woo Han, Do-Hee Kim, Byeong Moon Kim, Bong-Jin Lee" Structure-Based De Novo Design of Mycobacterium Tuberculosis VapC-Activating Stapled Peptides Stapled AMP DRAMP21625 ?LAAIRH? ZLAAIRHX ELAAIRHR 8 V30-SP-9 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A "33.8% -helix content in 50 M aqueous solution [a mixture of water and acetonitrile (9:1, v/v)]." "The helical propensities of two stapled peptides, V30-SP-8 and V30-SP-9, and their linear counterparts were analyzed via circular dichroism (CD) spectrometry. Surprisingly, in contrast to our expectation that the stitched peptide, V30-SP-8, would be more helical than the monostapled peptide, V30-SP-9, the monostapling strategy was more effective in inducing helicity (helicity: 26.1% for V30-SP-8 and 33.8% for V30-SP-9)" Not found Function: Antibacterial activity against Gram-positive bacteria. "[Ref.32840352] Gram-positive bacteria: Mycobacterium smegmatis (The antibacterial effects of V30-SP-8 are 23.3%, 23.3%, 34.2% and 38.7% at 6.25, 12.5, 25 and 50 M, and MIC50 is above 25 M)" [Ref.32840352] No hemolytic activity information found. Cyclic (Stapled) Free Free The ? (position: 1) in sequence is R8 stapling amino acid. Note: R8 is (R)-octenyl alanine. The ? (position: 8) in sequence is (S)-pentenyl alanine. ? (1) and ? (8) are cross-linked by hydrocarbon stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 32840352 ACS Chem Biol. 2020 Sep 18;15(9):2493-2498. doi: 10.1021/acschembio.0c00492. Epub 2020 Sep 9. "Sung-Min Kang, Heejo Moon, Sang-Woo Han, Do-Hee Kim, Byeong Moon Kim, Bong-Jin Lee" Structure-Based De Novo Design of Mycobacterium Tuberculosis VapC-Activating Stapled Peptides Stapled AMP DRAMP21628 TLKQF?KGV?KWLVK TLKQFXKGVXKWLVK TLKQFAKGVGKWLVK 15 E2EM15W-S1 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A 47% -helical content in a 25 mM potassium phosphate buffer solution at 20 . "On the other hand, all three stapled analogs of E2EM15W showed substantial increases in helical contents, which again demonstrated the highly effective helix-stabilization through the all-hydrocarbon stapling technology. E2EM15W-S1, the most potent analog in the antimicrobial assay, showed the highest degree of helicity (47%) in the aqueous solution, supporting a close correlation between the helicity and the antimicrobial activity of the peptides in this series." Not found Function: Antibcaterial activity against Gram-positive bacteria. Antibacterial activity against Gram-negative bacteria is not noteable under 200 g/mL. "[Ref.24211019] Gram-positive bacteria: Bacillus subtilis (MIC = 3.13 g/mL), Staphylococcus aureus (MIC = 3.13 g/mL), Staphylococcus epidermis (MIC > 200 g/mL);##Gram-negative bacteria: Escherichia coli (MIC > 200 g/mL), Shigella dysentariae (MIC > 200 g/mL), Salmonella typhimurium (MIC > 200 g/mL), Klebsiella pneumonia (MIC > 200 g/mL), Proteus mirabilis (MIC > 200 g/mL), Pseudomonas aeuginose (MIC > 200 g/mL)." [Ref.24211019] No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl staple." L No cytotoxicity information found in the reference 24211019 Bioorg Med Chem Lett. 2013 Dec 15;23(24):6717-20. doi: 10.1016/j.bmcl.2013.10.031. Epub 2013 Oct 26. "Thanh Kim Pham, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Truncated and constrained helical analogs of antimicrobial esculentin-2EM Stapled AMP DRAMP21629 TLKQF?KGW?KDLVK TLKQFXKGWXKDLVK TLKQFAKGVGKWLVK 15 E2EM15W-S2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 27% -helical content in a 25 mM potassium phosphate buffer solution at 20 . "On the other hand, all three stapled analogs of E2EM15W showed substantial increases in helical contents, which again demonstrated the highly effective helix-stabilization through the all-hydrocarbon stapling technology. Although they bear the oce-4-enyl staple at the same positions as in E2EM15W-S1, the other stapled derivatives E2EM15W-S2 and E2EM15W-S3 exhibited markedly smaller helical contents: 27% and 37%, repectively." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.24211019] Gram-positive bacteria: Bacillus subtilis (MIC = 6.25 g/mL), Staphylococcus aureus (MIC = 6.25 g/mL), Staphylococcus epidermis (MIC > 200 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 100 g/mL), Shigella dysentariae (MIC = 50 g/mL), Salmonella typhimurium (MIC > 200 g/mL), Klebsiella pneumonia (MIC = 50 g/mL), Proteus mirabilis (MIC > 200 g/mL), Pseudomonas aeuginose (MIC = 200 g/mL)." [Ref.24211019] No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl staple." L No cytotoxicity information found in the reference 24211019 Bioorg Med Chem Lett. 2013 Dec 15;23(24):6717-20. doi: 10.1016/j.bmcl.2013.10.031. Epub 2013 Oct 26. "Thanh Kim Pham, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Truncated and constrained helical analogs of antimicrobial esculentin-2EM Stapled AMP DRAMP21630 TLKQW?KGV?KDLVK TLKQWXKGVXKDLVK TLKQFAKGVGKWLVK 15 E2EM15W-S3 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A 37% -helical content in a 25 mM potassium phosphate buffer solution at 20 . "On the other hand, all three stapled analogs of E2EM15W showed substantial increases in helical contents, which again demonstrated the highly effective helix-stabilization through the all-hydrocarbon stapling technology. Although they bear the oce-4-enyl staple at the same positions as in E2EM15W-S1, the other stapled derivatives E2EM15W-S2 and E2EM15W-S3 exhibited markedly smaller helical contents: 27% and 37%, repectively." Not found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. "[Ref.24211019] Gram-positive bacteria: Bacillus subtilis (MIC = 6.25 g/mL), Staphylococcus aureus (MIC = 6.25 g/mL), Staphylococcus epidermis (MIC = 100 g/mL);##Gram-negative bacteria: Escherichia coli (MIC = 100 g/mL), Shigella dysentariae (MIC = 50 g/mL), Salmonella typhimurium (MIC > 200 g/mL), Klebsiella pneumonia (MIC = 50 g/mL), Proteus mirabilis (MIC > 200 g/mL), Pseudomonas aeuginose (MIC > 200 g/mL)." [Ref.24211019] No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation "The ? (position: 6 and 10) in sequence indicates (S)--methyl, -pentenylglycine. ? (6) and ? (10) are cross-linked by hydrocarbon stapling through an oct-4-enyl staple." L No cytotoxicity information found in the reference 24211019 Bioorg Med Chem Lett. 2013 Dec 15;23(24):6717-20. doi: 10.1016/j.bmcl.2013.10.031. Epub 2013 Oct 26. "Thanh Kim Pham, Do-Hee Kim, Bong-Jin Lee, Young-Woo Kim" Truncated and constrained helical analogs of antimicrobial esculentin-2EM Stapled AMP DRAMP28986 ?IKK?LKSAKKFVKAFK XIKKXLKSAKKFVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 2 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 3.125 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 1.56 M), multiple-drug resistant P.aeruginosa (MIC = 1.56 M)" [Ref.33466998] It has hemolysis against human red blood cells at 50 M Cyclic (Stapled) Free Amidation The ? (position: 1 and 5) in sequence indicate (S)-4-pentenyl alanine. ? (1) and ? (5) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28987 GIKK?LKS?KKFVKAFK GIKKXLKSXKKFVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 3 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 3.125 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 3.125 M), multiple-drug resistant P.aeruginosa (MIC = 0.78 M)" [Ref.33466998] It has hemolysis against human red blood cells at 6.25 M Cyclic (Stapled) Free Amidation The ? (position: 5 and 9) in sequence indicate (S)-4-pentenyl alanine. ? (5) and ? (9) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28988 GIKKFLK?AKK?VKAFK GIKKFLKXAKKXVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 4 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 6.25 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 1.56 M), multiple-drug resistant P.aeruginosa (MIC = 0.78 M)" [Ref.33466998] It has hemolysis against human red blood cells at 3.125 M Cyclic (Stapled) Free Amidation The ? (position: 8 and 12) in sequence indicates (S)-4-pentenyl alanine. ? (8) and ? (12) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28989 GIKKFLKS?KKF?KAFK GIKKFLKSXKKFXKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 5 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 12.5 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 6.25 M), multiple-drug resistant P.aeruginosa (MIC = 3.125 M)" [Ref.33466998] It has hemolysis against human red blood cells at 1.56 M Cyclic (Stapled) Free Amidation The ? (position: 9 and 13) in sequence indicate (S)-4-pentenyl alanine. ? (9) and ? (13) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28990 GIKKFLKSAKK?VKA?K GIKKFLKSAKKXVKAXK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 6 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 3.125 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 1.56 M), multiple-drug resistant P.aeruginosa (MIC = 0.78 M)" [Ref.33466998] It has hemolysis against human red blood cells at 3.125 M Cyclic (Stapled) Free Amidation The ? (position: 12 and 16) in sequence indicate (S)-4-pentenyl alanine. ? (12) and ? (16) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28991 GIKK?LKSAKK?VKAFK GIKKZLKSAKKXVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 7 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 25 M). ##Gram-negative bacteria: Escherichia coli (MIC = 3.125 M), Pseudomonas aeruginosa (MIC = 3.125 M), multiple-drug resistant P.aeruginosa (MIC = 1.56 M)" [Ref.33466998] It has hemolysis against human red blood cells at 6.25 M Cyclic (Stapled) Free Amidation The ? (position: 5) in sequence indicates (R)-7-octenyl alanine. The ? (position: 12) in sequence indicates (S)-4-pentenyl alanine. ? (5) and ? (12) are cross-linked by hydrocarbon stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28992 GIKKFLK?AKKFVK?FK GIKKFLKZAKKFVKXFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 8 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC > 50 M). ##Gram-negative bacteria: Escherichia coli (MIC = 6.25 M), Pseudomonas aeruginosa (MIC > 50 M), multiple-drug resistant P.aeruginosa (MIC = 3.125 M)" [Ref.33466998] It has hemolysis against human red blood cells at 0.19 M Cyclic (Stapled) Free Amidation The ? (position: 8) in sequence indicates (R)-7-octenyl alanine. The ? (position: 15) in sequence indicates (S)-4-pentenyl alanine. ? (8) and ? (15) are cross-linked by hydrocarbon stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28993 GIKKFLKS?KKFVKA?K GIKKFLKSZKKFVKAXK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide 9 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M "[Ref.33466998] All peptides with side-chain stapling showed negative maxima at around 208 and 222 nm, indicating that the peptides formed a stablized helical structure." Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 6.25 M). ##Gram-negative bacteria: Escherichia coli (MIC = 3.125 M), Pseudomonas aeruginosa (MIC = 6.25 M), multiple-drug resistant P.aeruginosa (MIC = 3.125 M)" [Ref.33466998] It has hemolysis against human red blood cells at 3.125 M Cyclic (Stapled) Free Amidation The ? (position: 9) in sequence indicates (R)-7-octenyl alanine. The ? (position: 16) in sequence indicates (S)-4-pentenyl alanine. ? (9) and ? (16) are cross-linked by hydrocarbon stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28994 ?IKK?LKSAKKFVKAFK XIKKXLKSAKKFVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide C6-2 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M [Ref.33466998] Peptide C6-2 and C12-2 showed a curve similar to that of peptide 2 Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 1.56 M). ##Gram-negative bacteria: Escherichia coli (MIC = 1.56 M), Pseudomonas aeruginosa (MIC = 3.125 M), multiple-drug resistant P.aeruginosa (MIC = 3.125 M)" [Ref.33466998] It has hemolysis against human red blood cells at 12.5 M Cyclic (Stapled) Hexanoylation Amidation The ? (position: 1 and 5) in sequence indicate (S)-4-pentenyl alanine. ? (1) and ? (5) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28995 ?IKK?LKSAKKFVKAFK XIKKXLKSAKKFVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide C12-2 (Derived from Mag2) No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A -helix in 20 mM PBS solution (pH = 7.4) with 1% SDS at peptide concentrations of 100 M [Ref.33466998] Peptide C6-2 and C12-2 showed a curve similar to that of peptide 2 Nor found Function: Antibacterial activity against Gram-positive and Gram-negative bacteria "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC = 6.25 M). ##Gram-negative bacteria: Escherichia coli (MIC = 6.25 M), Pseudomonas aeruginosa (MIC = 12.5 M), multiple-drug resistant P.aeruginosa (MIC = 25 M)" [Ref.33466998] It has hemolysis against human red blood cells at 0.78 M Cyclic (Stapled) Laurylation Amidation The ? (position: 1 and 5) in sequence indicate (S)-4-pentenyl alanine. ? (1) and ? (5) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28996 ?IKK?LKSAKKFVKAFK XIKKXLKSAKKFVKAFK GIGKFLHSAKKFGKAFVGEIMNS 17 peptide C18-2 (Derived from Mag2) No entry found N/A Synthetic construct Non-Antimicrobial N/A Unknown [Ref.33466998] The circular dichroism (CD) spectral analysis of C18-2 could not be performed because of its poor solubility in the aqueous buffer solution. Nor found Function: Antibacterial activity against bacteria is not significant under the concentration of 50 M. "[Ref.33466998] Gram-positive bacteria: Staphylococcus aureus (MIC > 50 M). ##Gram-negative bacteria: Escherichia coli (MIC > 50 M), Pseudomonas aeruginosa (MIC > 50 M), multiple-drug resistant P.aeruginosa (MIC > 50 M)" [Ref.33466998] It has hemolysis against human red blood cells at 0.78 M Cyclic (Stapled) Stearylation Amidation The ? (position: 1 and 5) in sequence indicate (S)-4-pentenyl alanine. ? (1) and ? (5) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33466998 Molecules. 2021 Jan 16;26(2):444. doi: 10.3390/molecules26020444. "Motoharu Hirano,?Chihiro Saito,?Hidetomo Yokoo,?Chihiro Goto,?Ryuji Kawano,?Takashi Misawa,?Yosuke Demizu" Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence Stapled AMP DRAMP28998 R?WWR?W RXWWRXW RWWWRWW 7 Stapled heptapeptide 2 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A Helicity = 61.3% in 10 mM sodium phosphate buffer (pH 7.4) at peptide concentrations of 100 M "CD spectroscopy was used to characterize the secondary structure of five unstapled heptapeptides and their stapled counterparts in phosphate buffer, indicating a significant increase in peptide helical content upon the stapling, with helicity change from h = 14.1% - 33.7% (for unstapled peptides) to h = 58.9%-75.1% (for stapled peptides)." Not found "Function: Antibacterial activity against Gram-positive bacteria. The stapled peptide was much more active against bacteria than the unstapled one." Gram-positive bacteria: Staphylococcus aureus ATCC25923 (MIC = 19 4 g/mL). Methicillin-resistant Staphylococcus aureus (MRSA) (MIC > 25 6 g/mL) No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) in sequence indicate (S)-4-pentenyl alanine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference PubMed ID is not available Int J Pept Res Ther. 2019 Nov 14; 26(4):1711C1719. doi: 10.1007/s10989-019-09964-7. "Zhixia Chen, Xiuli Yu, Aiying Zhang, Fangfang Wang, Yankun Xing" De Novo Hydrocarbon-Stapling Design of Single-Turn -Helical Antimicrobial Peptides Stapled AMP DRAMP29000 W?KWW?K WXKWWXK WWKWWWK 7 Stapled heptapeptide 4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A Helicity = 69.8% in 10 mM sodium phosphate buffer (pH 7.4) at peptide concentrations of 100 M "CD spectroscopy was used to characterize the secondary structure of five unstapled heptapeptides and their stapled counterparts in phosphate buffer, indicating a significant increase in peptide helical content upon the stapling, with helicity change from h = 14.1% - 33.7% (for unstapled peptides) to h = 58.9%-75.1% (for stapled peptides)." Not found "Function: Antibacterial activity against Gram-positive bacteria. The stapled peptide was much more active against bacteria than the unstapled one." Gram-positive bacteria: Staphylococcus aureus ATCC25923 (MIC = 8.3 1.8 g/mL). Methicillin-resistant Staphylococcus aureus (MRSA) (MIC = 14 3 g/mL) No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) in sequence indicate (S)-4-pentenyl alanine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference PubMed ID is not available Int J Pept Res Ther. 2019 Nov 14; 26(4):1711C1719. doi: 10.1007/s10989-019-09964-7. "Zhixia Chen, Xiuli Yu, Aiying Zhang, Fangfang Wang, Yankun Xing" De Novo Hydrocarbon-Stapling Design of Single-Turn -Helical Antimicrobial Peptides Stapled AMP DRAMP29002 L?LRL?R LXLRLXR LLLRLLR 7 Stapled heptapeptide 6 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A Helicity = 75.1% in 10 mM sodium phosphate buffer (pH 7.4) at peptide concentrations of 100 M "CD spectroscopy was used to characterize the secondary structure of five unstapled heptapeptides and their stapled counterparts in phosphate buffer, indicating a significant increase in peptide helical content upon the stapling, with helicity change from h = 14.1% - 33.7% (for unstapled peptides) to h = 58.9%-75.1% (for stapled peptides)." Not found "Function: Antibacterial activity against Gram-positive bacteria. The stapled peptide was much more active against bacteria than the unstapled one." Gram-positive bacteria: Staphylococcus aureus ATCC25923 (MIC = 24 4 g/mL). Methicillin-resistant Staphylococcus aureus (MRSA) (MIC = 15 3 g/mL) No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) in sequence indicate (S)-4-pentenyl alanine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference PubMed ID is not available Int J Pept Res Ther. 2019 Nov 14; 26(4):1711C1719. doi: 10.1007/s10989-019-09964-7. "Zhixia Chen, Xiuli Yu, Aiying Zhang, Fangfang Wang, Yankun Xing" De Novo Hydrocarbon-Stapling Design of Single-Turn -Helical Antimicrobial Peptides Stapled AMP DRAMP29004 W?RRW?R WXRRWXR WWRRWWR 7 Stapled heptapeptide 8 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+" N/A Helicity = 58.9% in 10 mM sodium phosphate buffer (pH 7.4) at peptide concentrations of 100 M "CD spectroscopy was used to characterize the secondary structure of five unstapled heptapeptides and their stapled counterparts in phosphate buffer, indicating a significant increase in peptide helical content upon the stapling, with helicity change from h = 14.1% - 33.7% (for unstapled peptides) to h = 58.9%-75.1% (for stapled peptides)." Not found "Function: Antibacterial activity against Gram-positive bacteria. The stapled peptide was much more active against bacteria than the unstapled one." Gram-positive bacteria: Staphylococcus aureus ATCC25923 (MIC = 56 12 g/mL). Methicillin-resistant Staphylococcus aureus (MRSA) (MIC = 72 18 g/mL) No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 2 and 6) in sequence indicate (S)-4-pentenyl alanine. ? (2) and ? (6) are cross-linked by hydrocarbon stapling through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference PubMed ID is not available Int J Pept Res Ther. 2019 Nov 14; 26(4):1711C1719. doi: 10.1007/s10989-019-09964-7. "Zhixia Chen, Xiuli Yu, Aiying Zhang, Fangfang Wang, Yankun Xing" De Novo Hydrocarbon-Stapling Design of Single-Turn -Helical Antimicrobial Peptides Stapled AMP DRAMP29007 G?FAV?KKVASVIKGL GXFAVXKKVASVIKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp1 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 89.8% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" "[Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Among them, A4K14-citropin 1.1-Sp1 and A4K14-citropin 1.1-Sp4 displayed the top 2 degrees of helicity (89.8 and 85.3%, respectively) in the aqueous solution and acquired 1.46- and 1.38-fold improvements compared to A4K14-citropin 1.1, respectively." Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells. The hydrolysis enzyme (-chymotrypsin-mediated) degradation half-life of A4K14-citropin1.1-Sp1 is over 10 hours. A4K14-citropin1.1-Sp1 and A4K14-citropin1.1-Sp4 are much more stable than other A4K14-citropin1.1 stapling derivatives in Ref.33363118." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 8.94 M), A549 (IC50 = 12.48 M), U87 (IC50 = 11.88 M), MCF-7 (11.26 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 2 and 6) in sequence indicate (S)-2-(4-pentenyl)alanine. ? (2) and ? (6) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29008 GLFA?IKK?ASVIKGL GLFAXIKKXASVIKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp2 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 66.1% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" [Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 10.14 M), A549 (IC50 = 12.55 M), U87 (IC50 = 14.76 M), MCF-7 (12.65 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 5 and 9) in sequence indicate (S)-2-(4-pentenyl)alanine. ? (5) and ? (9) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29009 GLFAV?KKV?SVIKGL GLFAVXKKVXSVIKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp3 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 49.2% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" [Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 17.89 M), A549 (IC50 = 12.11 M), U87 (IC50 = 11.93 M), MCF-7 (11.92 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 6 and 10) in sequence indicate (S)-2-(4-pentenyl)alanine. ? (6) and ? (10) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29010 GLFAVIKK?ASV?KGL GLFAVIKKXASVXKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp4 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 85.3% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" "[Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%.Among them, A4K14-citropin 1.1-Sp1 and A4K14-citropin 1.1-Sp4 displayed the top 2 degrees of helicity (89.8 and 85.3%, respectively) in the aqueous solution and acquired 1.46- and 1.38-fold improvements compared to A4K14-citropin 1.1, respectively." Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells. The hydrolysis enzyme (-chymotrypsin-mediated) degradation half-life of A4K14-citropin1.1-Sp1 is over 10 hours. A4K14-citropin1.1-Sp1 and A4K14-citropin1.1-Sp4 are much more stable than other A4K14-citropin1.1 stapling derivatives in Ref.33363118." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 8.90 M), A549 (IC50 = 10.51 M), U87 (IC50 = 7.277 M), MCF-7 (10.49 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 9 and 13) in sequence indicate (S)-2-(4-pentenyl)alanine. ? (9) and ? (13) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29011 GLFAVIKKVA?VIK?L GLFAVIKKVAXVIKXL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp5 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 49.4% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" [Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 11.90 M), A549 (IC50 = 9.899 M), U87 (IC50 = 8.229 M), MCF-7 (12.42 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 11 and 15) in sequence indicate (S)-2-(4-pentenyl)alanine. ? (11) and ? (15) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29012 G?FAVIKK?ASVIKGL GZFAVIKKXASVIKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp6 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 34.9% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" [Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 35.84 M), A549 (IC50 = 30.19 M), U87 (IC50 = 34.49 M), MCF-7 (23.78 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 2) in sequence indicates (R)-2-(7-octenyl)alanine. The ? (position: 9) in sequence indicates (S)-2-(4-pentenyl)alanine. ? and ? are cross-linked by ring-closing metathesis through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29013 GLFAV?KKVASV?KGL GLFAVZKKVASVXKGL GLFAVIKKVASVIKGL 16 A4K14-citropin1.1-Sp7 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A "Helicity = 13.6% in 50% 2,2,2-trifluoroethanol (TFE) aqueous solution (0.1mg/mL)" [Ref.33363118] CD analysis indicates that the helicity of intial A4K14-citropin 1.1 was 61.5% and that of the stapled peptides ranged from 13.6 to 89.8%. Not found "Function: Antitumor activity against A549, HCT116 and HepG2 cancer cells." "[Ref.33363118] Cancer cell lines: C4-2B (IC50 = 10.23 M), A549 (IC50 = 16.37 M), U87 (IC50 = 14.72 M), MCF-7 (12.1 M)" No hemolytic activity information found. Cyclic (Stapled) Acetylation Amidation The ? (position: 6) in sequence indicates (R)-2-(7-octenyl)alanine. The ? (position: 13) in sequence indicates (S)-2-(4-pentenyl)alanine. ? and ? are cross-linked by ring-closing metathesis through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33363118 Front Chem. 2020 Dec 10;8:616147. doi: 10.3389/fchem.2020.616147. eCollection 2020. "Nan Wang, Gang Xie, Chao Liu, Wei Cong, Shipeng He, Yinghua Li, Li Fan, Hong-Gang Hu " "Design, Synthesis, and Antitumor Activities Study of Stapled A4K14-Citropin 1.1 Peptides" Stapled AMP DRAMP29015 IKLSP?TKD?LKKVLKGAIKGAIAVAKMV IKLSPXTKDXLKKVLKGAIKGAIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-2 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 4.26 0.52 M), HCT116 (IC50 = 3.54 0.72 M), HepG2 (IC50 = 1.60 0.24 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29016 IKLSPETKDNLKKVLKG?IKG?IAVAKMV IKLSPETKDNLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-5 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 7.35 0.22 M), HCT116 (IC50 = 4.16 0.21 M), HepG2 (IC50 = 2.82 0.23 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29017 IKLSP?TKD?LKKVLKG?IKG?IAVAKMV IKLSPXTKDXLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-10 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 3.59 0.12 M), HCT116 (IC50 = 3.51 0.37 M), HepG2 (IC50 = 1.50 0.21 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation " The ? (position: 6, 10, 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10), ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple, respectively." L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29019 IKLSK?TKD?LKKVLKGAIKGAIAVAKMV IKLSKXTKDXLKKVLKGAIKGAIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-15 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 2.26 0.24 M), HCT116 (IC50 = 2.95 0.25 M), HepG2 (IC50 = 2.20 0.27 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29020 IKLSP?TKK?LKKVLKGAIKGAIAVAKMV IKLSPXTKKXLKKVLKGAIKGAIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-16 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 1.85 0.31 M), HCT116 (IC50 = 2.65 0.35 M), HepG2 (IC50 = 3.14 0.46 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29021 IKLSK?TKK?LKKVLKGAIKGAIAVAKMV IKLSKXTKKXLKKVLKGAIKGAIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-17 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 0.96 0.33 M), HCT116 (IC50 = 1.49 0.45 M), HepG2 (IC50 = 1.64 0.47 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation The ? (position: 6 and 10) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29022 IKLSKKTKKNLKKVLKG?IKG?IAVAKMV IKLSKKTKKNLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-18 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 0.89 0.21 M), HCT116 (IC50 = 1.11 0.21 M), HepG2 (IC50 = 1.61 0.21 M)" "[Ref.30789695] It has -1.5%, 3.8%, 12.8%, 18.2%, 13.8%, 30.2%, 65.2%, 90.8% and 83.5% hemolysis against fresh rabbit blood cells at 0.010, 0.25, 0.5, 1.0, 2.0, 5.0, 10.0, 20.0 and 25.0 M." Cyclic (Stapled) Free Amidation The ? (position: 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29023 IKLSKETKKNLKKVLKG?IKG?IAVAKMV IKLSKETKKNLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-19 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 1.00 0.36 M), HCT116 (IC50 = 1.78 0.35 M), HepG2 (IC50 = 1.64 0.36 M)" "[Ref.30789695] It has 1.8%, 11.5%, 22.2%, 20.5%, 16.2%, 39.5%, 69.2%, 94.8% and 102.5% hemolysis against fresh rabbit blood cells at 0.010, 0.25, 0.5, 1.0, 2.0, 5.0, 10.0, 20.0 and 25.0 M." Cyclic (Stapled) Free Amidation The ? (position: 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple. L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29024 IKLSP?TKK?LKKVLKG?IKG?IAVAKMV IKLSPXTKKXLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-20 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 2.10 0.32 M), HCT116 (IC50 = 2.63 0.35 M), HepG2 (IC50 = 4.93 0.53 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation " The ? (position: 6, 10, 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10), ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple, respectively." L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29025 IKLSK?TKK?LKKVLKG?IKG?IAVAKMV IKLSKXTKKXLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-21 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 3.26 0.36 M), HCT116 (IC50 = 3.05 0.21 M), HepG2 (IC50 = 1.50 0.28 M)" No hemolytic activity information found. Cyclic (Stapled) Free Amidation " The ? (position: 6, 10, 18 and 22) in sequence indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (6) and ? (10), ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple, respectively." L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29026 IKLSKETKKNLKKVLKG?IKG?IAVAKMV IKLSKETKKNLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-57 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 1.10 0.31 M), HCT116 (IC50 = 1.65 0.28 M), HepG2 (IC50 = 2.71 0.05 M)" "[Ref.30789695] It has -1.2%, 1.8%, 2.8%, 5.5%, 14.5%, 25.8%, 42.8%, 68.8% and 58.2% hemolysis against fresh rabbit blood cells at 0.010, 0.25, 0.5, 1.0, 2.0, 5.0, 10.0, 20.0 and 25.0 M." Cyclic (Stapled) Free Amidation " The S (position: 4), T (position: 7) and N (position: 10) in sequence are linked with N-acetylglucosamine (GlcNAc), respectively. The ? (position: 18 and 22) indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple, respectively." L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29027 IKLSKKTKKNLKKVLKG?IKG?IAVAKMV IKLSKKTKKNLKKVLKGXIKGXIAVAKMV IKLSPETKDNLKKVLKGAIKGAIAVAKMV 29 H-58 No entry found N/A Synthetic construct "Antimicrobial, Anticancer" N/A -helical (most likely) No detailed structure description found. Not found "Function: Anticancer activity. Ref.30789695 does not include results of antimicrobial, hemolysis and other biological assays" "[Ref.30789695] Cancer cell lines: A549 (IC50 = 0.62 0.12 M), HCT116 (IC50 = 1.29 0.08 M), HepG2 (IC50 = 2.13 0.07 M)" "[Ref.30789695] It has 0.8%, -0.5%, 0.8%, 8.8%, 13.2%, 20.8%, 37.8%, 61.8% and 54.5% hemolysis against fresh rabbit blood cells at 0.010, 0.25, 0.5, 1.0, 2.0, 5.0, 10.0, 20.0 and 25.0 M." Cyclic (Stapled) Free Amidation " The S (position: 4), T (position: 7) and N (position: 10) in sequence are linked with N-acetylglucosamine (GlcNAc), respectively. The ? (position: 18 and 22) indicate (S)-N-Fmoc-2-(4'-pentenyl)alanine. ? (18) and ? (22) are cross-linked by ring-closing metathesis through an oct-4-enyl hydrocarbon staple, respectively." L No cytotoxicity information found in the reference 30789695 ACS Chem Biol. 2019 Mar 15;14(3):516-525. doi: 10.1021/acschembio.9b00046. Epub 2019 Mar 1. "Yulei Li,?Yihan Zhang,?Minghao Wu,?Qi Chang,?Honggang Hu,?Xia Zhao" "Improving Selectivity, Proteolytic Stability, and Antitumor Activity of Hymenochirin-1B: A Novel Glycosylated Staple Strategy" Stapled AMP DRAMP29032 KLLKKAGKLLKK?GKLLKK?G KLLKKAGKLLKKZGKLLKKXG KLLKKAGKLLKKAGKLLKKAG 21 Stripe-based foldamer peptide 4 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "-Helix content = 39% in 20 mM phosphate buffered saline (PBS) solution (pH 7.4), with 1% sodium dodecyl sulfate" "[Ref.33369262] As shown in Figure 2, peptides 2, 3, 4 and 5 showed negative maxima at around 208 and 222nm, which suggests that they formed stable -helical structures, similar to Stripe." Not found "Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. It is a helical foldmer peptide based on ""Stripe"" (an AMP manually designed) by introducing a hydrocarbon stapling. The peptide showed weaker activity than Stripe." "[Ref.33369262] Gram-positive bacteria: Staphylococcus aureus NBRC13276 (MIC = 25 M) ;##Gram-negative bacteria: Escherichia coli DH5 (MIC = 6.25 M), Pseudomonas aeruginosa NBRC13275 (MIC = 50 M), multidrug-resistant Pseudomonas aeruginosa ATCCBAA-2111 (MDRP) (MIC = 25 M)" [Ref.33369262] It exhibits hemolysis at 0.78 M agasint human red blood cells. Cyclic (Stapled) Free Free The ? (position: 13) in sequence denotes (R)-(7-octenyl)alanine. The ? (position: 20) in sequence denotes (S)-(4-pentenyl)alanine. ? (13) and ? (20) are cross-linked by side-stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33369262 Chempluschem. 2020 Dec;85(12):2731-2736. doi: 10.1002/cplu.202000749. "Motoharu Hirano, Chihiro Saito, Chihiro Goto, Hidetomo Yokoo, Ryuji Kawano, Takashi Misawa, Yosuke Demizu" "Rational Design of Helix-Stabilized Antimicrobial Peptide Foldamers Containing ,-Disubstituted Amino Acids or Side-Chain Stapling" Stapled AMP DRAMP29033 KLLKK?GKLLKK?GKLLKKAG KLLKKZGKLLKKXGKLLKKAG KLLKKAGKLLKKAGKLLKKAG 21 Stripe-based foldamer peptide 5 No entry found N/A Synthetic construct "Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-" N/A "-Helix content = 34% in 20 mM phosphate buffered saline (PBS) solution (pH 7.4), with 1% sodium dodecyl sulfate" "[Ref.33369262] As shown in Figure 2, peptides 2, 3, 4 and 5 showed negative maxima at around 208 and 222nm, which suggests that they formed stable -helical structures, similar to Stripe." Not found "Function: Antibacterial activity against Gram-positive and Gram-negative bacteria. It is a helical foldmer peptide based on ""Stripe"" (an AMP manually designed) by introducing a hydrocarbon stapling. The peptide showed weaker activity than Stripe." "[Ref.33369262] Gram-positive bacteria: Staphylococcus aureus NBRC13276 (MIC = 25 M) ;##Gram-negative bacteria: Escherichia coli DH5 (MIC = 6.25 M), Pseudomonas aeruginosa NBRC13275 (MIC = 12.5 M), multidrug-resistant Pseudomonas aeruginosa ATCCBAA-2111 (MDRP) (MIC = 25 M)" [Ref.33369262] It exhibits hemolysis at 1.56 M agasint human red blood cells. Cyclic (Stapled) Free Free The ? (position: 6) in sequence denotes (R)-(7-octenyl)alanine. The ? (position: 13) in sequence denotes (S)-(4-pentenyl)alanine. ? (6) and ? (13) are cross-linked by side-stapling through a undec-4-enyl staple. L No cytotoxicity information found in the reference 33369262 Chempluschem. 2020 Dec;85(12):2731-2736. doi: 10.1002/cplu.202000749. "Motoharu Hirano, Chihiro Saito, Chihiro Goto, Hidetomo Yokoo, Ryuji Kawano, Takashi Misawa, Yosuke Demizu" "Rational Design of Helix-Stabilized Antimicrobial Peptide Foldamers Containing ,-Disubstituted Amino Acids or Side-Chain Stapling" Stapled AMP DRAMP29235 TIEEQAKT?LDK?NHEAEDLFYQ?SLA?WN TIEEQAKTXLDKXNHEAEDLFYQXSLAXWN TIEEQAKTFLDKFNHEAEDLFYQSSLASWN 30 NYBSP-1 No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 94% -helical content in 10?mM phosphate-buffered saline (PBS) No other descriptive information about the structure found in the literature Not found "Mechanism of action:The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection." [Ref.33310780]Virus:##SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=4.1 0.26 M);Inhibition of infection in A549/ACE2 cells(IC50=2.2 0.14 M);Inhibition of virus-induced cytopathic effect (CPE) in Vero E6 cells(IC100=17.2 M);##VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>27.5 M);Inhibition of infection in A549/ACE2 cells(IC50>27.5 M). No hemolytic activity information found. Cyclic (Stapled) Acylation Amidation "The ? (position: 9,13,24 and 28) in sequence indicate S-2-(4'-pentenyl) alanine. ?(9) and ?(13), ?(24) and ?(28) are cross-linked by hydrocarbon stapling." L [Ref.33310780]HT1080/ACE2 cells:CC50>27.5 M(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>27.5 M(Less than 10% toxicity at this dose). 33310780 mBio. 2020 Dec 11;11(6):e02451-20. "Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK." Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro. Stapled AMP DRAMP29236 TIEEQ?KTFLDK?NHEAEDL?YQSSLA?WN TIEEQZKTFLDKXNHEAEDLZYQSSLAXWN TIEEQAKTFLDKFNHEAEDLFYQSSLASWN 30 NYBSP-2 No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 61% -helical content in 10?mM phosphate-buffered saline (PBS) No other descriptive information about the structure found in the literature Not found "Mechanism of action:The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection." [Ref.33310780]Virus:##SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=2.9 0.27 M);Inhibition of infection in A549/ACE2 cells(IC50=2.68 0.14 M);Inhibition of virus-induced cytopathic effect (CPE) in Vero E6 cells(IC100=33.5 M);##VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>26.8 M);Inhibition of infection in A549/ACE2 cells(IC50>26.8 M). No hemolytic activity information found. Cyclic (Stapled) Acylation Amidation "The ?(position: 13 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.The ?(position: 6 and 21) indicate 2-(7'-octenyl) alanine in the R configuration. ?(6) and ?(13), ?(21) and ?(28) are cross-linked by hydrocarbon stapling." L [Ref.33310780]HT1080/ACE2 cells:CC50>26.8 M(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>26.8 M(Less than 10% toxicity at this dose). 33310780 mBio. 2020 Dec 11;11(6):e02451-20. "Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK." Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro. Stapled AMP DRAMP29237 TIEEQAKT?LDK?NHEAEDL?YQSSLA?WN TIEEQAKTXLDKXNHEAEDLZYQSSLAXWN TIEEQAKTFLDKFNHEAEDLFYQSSLASWN 30 NYBSP-3 No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 50% -helical content in 10?mM phosphate-buffered saline (PBS) No other descriptive information about the structure found in the literature Not found "Mechanism of action:The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection." [Ref.33310780]Virus:##SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=12.9 0.35 M);Inhibition of infection in A549/ACE2 cells(IC50~25 M);##VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>27.6 M);Inhibition of infection in A549/ACE2 cells(IC50>27.6 M). No hemolytic activity information found. Cyclic (Stapled) Acylation Amidation "The ? (position: 9,13 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.The ? (position: 21) indicates 2-(7'-octenyl) alanine in the R configuration. ?(9) and ?(13), ?(21) and ?(28) are cross-linked by hydrocarbon stapling." L [Ref.33310780]HT1080/ACE2 cells:CC50>27.6 M(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>27.6 M(Less than 10% toxicity at this dose). 33310780 mBio. 2020 Dec 11;11(6):e02451-20. "Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK." Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro. Stapled AMP DRAMP29238 TIEEQ?KTFLDK?NHEAEDLFYQ?SLA?WN TIEEQZKTFLDKXNHEAEDLFYQXSLAXWN TIEEQAKTFLDKFNHEAEDLFYQSSLASWN 30 NYBSP-4 No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 80% -helical content in 10?mM phosphate-buffered saline (PBS) No other descriptive information about the structure found in the literature Not found "Mechanism of action:Proteolytic stability of NYBSP-4 in human plasma(half-life (T1/2) of NYBSP-4 was >289?min).The stapled peptide designed based on the ACE2 helix, which is expected to bind to SARS-CoV-2 and prevent the binding of the virus to the ACE2 receptor and disrupt the infection." [Ref.33310780]Virus:##SARS-CoV-2:Inhibition of infection in HT1080/ACE2 cells(IC50=1.97 0.14 M);Inhibition of infection in A549/ACE2 cells(IC50=2.8 0.08 M);Inhibition of virus-induced cytopathic effect (CPE) in Vero E6 cells(IC100=33 M);##VSV-G:Inhibition of infection in HT1080/ACE2 cells(IC50>26.6 M);Inhibition of infection in A549/ACE2 cells(IC50>26.6 M). No hemolytic activity information found. Cyclic (Stapled) Acylation Amidation "The ? (position: 13,24 and 28) in sequence indicate S-2-(4'-pentenyl) alanine.The ? (position: 6) indicates 2-(7'-octenyl) alanine in the R configuration. ?(6) and ?(13), ?(24) and ?(28) are cross-linked by hydrocarbon stapling." L [Ref.33310780]HT1080/ACE2 cells:CC50>26.6 M(Less than 10% toxicity at this dose);A549/ACE2 cells:CC50>26.6 M(Less than 10% toxicity at this dose). 33310780 mBio. 2020 Dec 11;11(6):e02451-20. "Curreli F, Victor SMB, Ahmed S, Drelich A, Tong X, Tseng CK, Hillyer CD, Debnath AK." Stapled Peptides Based on Human Angiotensin-Converting Enzyme 2 (ACE2) Potently Inhibit SARS-CoV-2 Infection In Vitro. Stapled AMP DRAMP29239 IEEQAKTFLDKFNHE?EDL?YQSSLASWNYNTNIT IEEQAKTFLDKFNHEKEDLEYQSSLASWNYNTNIT IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNIT 35 hACE2(21-55)A36K-F40E No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 52% -helical content in 10 mM PBS at pH 7.4 with 30% TFE at 298 K.6-13% -helical content in 10 mM PBS at pH 7.4 and 298 K. "Low helicity for stapled hACE2 peptides in absence of TFE, with predictors of helicity averaging to 6-13% helical content. In the presence of TFE, -helical structures can be observed for various synthetic hACE2 peptides with predictors averaging from 11 to 52% helical content" Not found "Mechanism of action:The stapled peptide inhibit the RBD-hACE2 complex formation, and hACE2 1-helix-based peptidomimetics could potentially prevent SARS-CoV-2 from entering the human cells through hACE2 and thus inhibit subsequent viral replication. " [Ref.33651072]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 Spike protein-hACE2 complex formation(IC50=3.6 M). No hemolytic activity information found. Cyclic (Stapled) Free Free ? (16) and ? (20) are corss-linked by lactam stapling. L No cytotoxicity information found in the reference(s) presented 33651072 Chem Commun (Camb). 2021 Apr 4;57(26):3283-3286. "Maas MN , Hintzen JCJ , L?ffler PMG , Mecinovi? J . " Targeting SARS-CoV-2 spike protein by stapled hACE2 peptides. Stapled AMP DRAMP29240 IEEQAKTFLDK?NHE?EDLFYQSSLASWNYNTNIT IEEQAKTFLDKKNHEEEDLFYQSSLASWNYNTNIT IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNIT 35 hACE2(21-55)F32K-A36E No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 6-13% -helical content in 10 mM PBS at pH 7.4 and 298 K.11-52% -helical content in 10 mM PBS at pH 7.4 with 30% TFE at 298 K. "Low helicity for stapled hACE2 peptides in absence of TFE, with predictors of helicity averaging to 6-13% helical content. In the presence of TFE, -helical structures can be observed for various synthetic hACE2 peptides with predictors averaging from 11 to 52% helical content" Not found "Mechanism of action:The stapled peptide inhibit the RBD-hACE2 complex formation, and hACE2 1-helix-based peptidomimetics could potentially prevent SARS-CoV-2 from entering the human cells through hACE2 and thus inhibit subsequent viral replication. " [Ref.33651072]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 Spike protein-hACE2 complex formation(IC50=28.4 M). No hemolytic activity information found. Cyclic (Stapled) Free Free ? (12) and ? (16) are corss-linked by lactam stapling. L No cytotoxicity information found in the reference(s) presented 33651072 Chem Commun (Camb). 2021 Apr 4;57(26):3283-3286. "Maas MN , Hintzen JCJ , L?ffler PMG , Mecinovi? J . " Targeting SARS-CoV-2 spike protein by stapled hACE2 peptides. Stapled AMP DRAMP29241 IEEQAKT?LDK?NHEAEDLFYQSSLASWNYNTNIT IEEQAKTKLDKENHEAEDLFYQSSLASWNYNTNIT IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNIT 35 hACE2(21-55)F28K-F32E No entry found N/A Synthetic construct "Antimicrobial, Antiviral(SARS-CoV-2)" N/A 6-13% -helical content in 10 mM PBS at pH 7.4 and 298 K.11-52% -helical content in 10 mM PBS at pH 7.4 with 30% TFE at 298 K. "Low helicity for stapled hACE2 peptides in absence of TFE, with predictors of helicity averaging to 6-13% helical content. In the presence of TFE, -helical structures can be observed for various synthetic hACE2 peptides with predictors averaging from 11 to 52% helical content" Not found "Mechanism of action:The stapled peptide inhibit the RBD-hACE2 complex formation, and hACE2 1-helix-based peptidomimetics could potentially prevent SARS-CoV-2 from entering the human cells through hACE2 and thus inhibit subsequent viral replication. " [Ref.33651072]Virus:SARS-CoV-2:inhibition of SARS-CoV-2 Spike protein-hACE2 complex formation(IC50=46.8 M). No hemolytic activity information found. Cyclic (Stapled) Free Free ? (8) and ? (12) are corss-linked by lactam stapling. L No cytotoxicity information found in the reference(s) presented 33651072 Chem Commun (Camb). 2021 Apr 4;57(26):3283-3286. "Maas MN , Hintzen JCJ , L?ffler PMG , Mecinovi? J . " Targeting SARS-CoV-2 spike protein by stapled hACE2 peptides. Stapled AMP