• DRAMP ID

    • DRAMP00074
    • Peptide Name

    • Enterocin P (Pediocin-like peptide; Bacteriocin)
    • Source

    • Enterococcus faecium P13 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • entP
    • Sequence

    • ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • [Ref.9361419]Gram-positive bacteria:
        Target OrganismActivity
        Pediococcus acidilacticiMIC=69 ng/ml
        Pediococcus pentosaceus FBB61MIC=136 ng/ml
        P. pntosaceus FBB63MIC=18 ng/ml
        Lactococcus lactis BB24MIC=22 ng/ml
        Enterococcus faeciumMIC=2 ng/ml
        E. faecalisMIC=238 ng/ml
        Staphylococcus carnosusMIC=139 ng/ml
        Bacillus cereusMIC=286 ng/ml
        Clostridium sporogenesMIC=4 ng/ml
        Clostridium tyrobutyricum 3-
        5CTMIC=559 ng/ml
        C. tyrobutyricum 1754MIC=412 ng/ml
        Propionibacteruim sp P4MIC=37 ng/ml
        Propionibacteruim sp P6MIC=26 ng/ml
        Clostridium tyrobutyricumMIC=4 ng/ml
        Clostridium botulinumMIC=259 ng/ml
        Listeria monocytogenes 7973MIC=35 ng/ml
        L. monocytogenes LI5sv1/2MIC=33 ng/ml
        L. monocytogenes 5105MIC=18 ng/ml
        L. monocytogenes L11sv4MIC=39 ng/ml
        L. monocytogenes Scott AMIC=125 ng/ml
        Listeria innocuaMIC=395 ng/ml
        Streptococcus aureus 137MIC=190 ng/ml
        S. aureus 196EMIC=407 ng/ml
        S. aureus 349MIC=221 ng/ml
        S. aureus 361MIC=294 ng/ml
        S. aureus 472MIC=269 ng/ml
        Lactobacillus curvatusMIC=17 ng/ml
        L. fermentumMIC=1 ng/ml
        L. sakeMIC=144 ng/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Stereochemistry

    • L
    • PDB ID

    • Predicted Structure

    • Formula

    • C202H303N59O61S3
    • Absent Amino Acids

    • DFPQ
    • Common Amino Acids

    • G
    • Mass

    • 4630.17
    • PI

    • 8.07
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +2
    • Boman Index

    • -33.68
    • Hydrophobicity

    • -0.15
    • Aliphatic Index

    • 66.59
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 455.93
    • Polar Residues

    • 22

DRAMP00074

DRAMP00074 chydropathy plot
    • Function

    • Bacteriocin that inhibits the growth of wide range of Gram-positive bacterial species. Does not inhibit the growth of several strains of Gram-negative bacteria. No hemolytic activity against calf blood.
    • Biophysicochemical properties

    • pH dependence (Stable between pH 3.0 and pH 7.0); Temperature dependence (Thermostable, retains activity after heating at 100 and 121 degrees Celsius).
    • PTM

    • Contains one disulfide bond 11-16.
  • ·Literature 1
    • Title

    • Biochemical and genetic characterization of enterocin P, a novel sec-dependent bacteriocin from Enterococcus faecium P13 with a broad antimicrobial spectrum.
    • Reference

    • Appl Environ Microbiol. 1997 Nov;63(11):4321-4330.
    • Author

    • Cintas LM, Casaus P, H¥varstein LS, Hern¡ndez PE, Nes IF.
  • ·Literature 2
    • Title

    • Single nucleotide polymorphism analysis of the enterocin P structural gene of Enterococcus faecium strains isolated from nonfermented animal foods.
    • Reference

    • Mol Nutr Food Res. 2006 Dec;50(12):1229-1238.
    • Author

    • Arlindo S, Calo P, Franco C, Prado M, Cepeda A, Barros-Vel¡zquez J.